Verteidiger der Krone – Wikipedia

Verteidiger der Krone
DefenderOfTheCrown.jpg
Entwickler Cinemaware
Verlag) Cinemaware
Designer Kellyn Beck
Künstler James D. Sachs
Komponist (en) Jim Cuomo
Plattform (en) Amiga, C64, Atari ST, MS-DOS, Macintosh, Apple IIGS, Amstrad CPC, ZX Spectrum, NES, CDTV, CD-i, Windows, Game Boy Advance, Mobiltelefon, iOS, Android, Jaguar
Freisetzung 1986
Genre (s) Strategiespiel
Modus (e) Einzelspieler

Verteidiger der Krone ist ein Strategie-Computerspiel von Kellyn Beck. Es war das erste Spiel von Cinemaware und wurde ursprünglich 1986 für den Commodore Amiga veröffentlicht. Damit setzte es einen neuen Standard für die Grafikqualität in Heimcomputerspielen.

1987 wurde es auf den Commodore 64, Atari ST, MS-DOS und Macintosh portiert. Es wurde später auf das Nintendo Entertainment System (NES), Amstrad CPC, ZX Spectrum und Apple II portiertGS, CDTV, CD-i und Atari Jaguar.

Spielweise[edit]

Das Spiel spielt 1149 im Mittelalter in England, wo nach dem Tod des Königs verschiedene Fraktionen um die territoriale Kontrolle kämpfen.

Der Kampfbildschirm war eine der Funktionen, die der Atari ST-Version hinzugefügt wurden

Der Spieler übernimmt die Rolle eines Sachsen (Wilfred von Ivanhoe, Cedric von Rotherwood, Geoffrey Longsword oder Wolfric the Wild) und versucht, die normannischen Horden abzuwehren und um die Kontrolle über England zu kämpfen. Schließlich muss der Spieler um die Kontrolle über alle Gebiete kämpfen, und möglicherweise über die Gebiete, die von anderen Sachsen kontrolliert werden, wenn sie antagonistisch geworden sind. Der Spieler muss Armeen anhäufen und um die Kontrolle über die Burgen des Gegners kämpfen. Der Spieler kann feindliche Armeen in den Kampf verwickeln und gegnerische Burgen plündern oder belagern. Territorien können auch in den regelmäßigen Turnierwettbewerben gewonnen werden. Von Zeit zu Zeit kann der Spieler versuchen, eine in Not geratene Jungfrau zu retten, und den legendären Banditen Robin Hood um Hilfe bitten.

Die Strategie des Spiels läuft auf einen Zermürbungskrieg hinaus, da der Spieler versucht, größere Armeen als seine Gegner anzuhäufen und es schafft, ihre Gebiete zum richtigen Zeitpunkt anzugreifen.

Aus finanziellen Gründen entschied sich Cinemaware, die ursprüngliche Version ohne alle ursprünglich geplanten Funktionen zu veröffentlichen, da Einnahmen erforderlich waren. Einige Funktionen wurden teilweise implementiert, aber entfernt, damit das Spiel ausgeliefert werden konnte. Einige zusätzliche Funktionen, die abgeschlossen, aber im ausgelieferten Spiel noch nie gesehen wurden, umfassen brennende Feuerbälle (über das Katapult gestartet), mehr Orte (abwechslungsreichere Burgen zum Angriff) und eine detailliertere Strategie. Einige dieser Funktionen wurden in den Ports des Spiels implementiert.

James D. Sachs, der Hauptkünstler des Spiels, zeigte einige dieser Funktionen auf dem Amiga in Interviews nach der Veröffentlichung des Spiels.

Rezeption[edit]

Die erste öffentliche Demonstration von Verteidiger der Krone trat auf der Los Angeles Commodore Show im September 1986 vor ihrer Veröffentlichung im November auf und zog eine große Menge an.[1] Das Spiel überraschte diejenigen, die es zum ersten Mal sahen:[2]

Screenshot eines Überfalls mit Grafiken in der Amiga-Version von 1986.

Der Mical-Sägekünstler Jim Sachs hat den Amiga voll ausgeschöpft. „Jim Sachs, was für ein Gott er ist“, wundert sich Mical. „Jim Sachs ist unglaublich. Heutzutage sieht jeder solche Grafiken, weil es jetzt viele wirklich gute Computergrafiker gibt, aber damals, vor 20 Jahren, war es erstaunlich, jemanden so gut zu haben.“

Das letzte Spiel war ein Meilenstein in den Produktionswerten von Videospielen. Der Spieledesigner Bob Lindstrom erinnert sich: „Der Schock des Sehens Verteidiger Zum ersten Mal war eine dieser Erfahrungen, die den Spieleinsatz für uns alle verändert haben. “

Im Vergleich zu anderen Videospielen der Zeit, Verteidiger der Krone ein neues Qualitätsniveau etabliert. IBM hatte Kings Quest von Sierra On-Line, einem anständigen, aber primitiven Abenteuerspiel. Der Macintosh hatte Spiele wie Checkers oder Backgammon oder Brettspiele wie Risiko. Verteidiger der Krone hatte eine reichhaltigere Grafik als jeder Computer, jede Konsole oder sogar jedes Arcade-Spiel im Jahr 1986. Es war eine Offenbarung.

Verteidiger der Krone wurde ein kommerzieller Hit. Im Jahr 1989 Videospiele & Computerunterhaltung berichteten, dass es von „fast einer dreiviertel Million Spielern weltweit“ gekauft wurde.[3] Der Absatz hatte bis 2001 1 Million Einheiten überschritten.[4]

Die Info gab der Amiga-Version vier von fünf Sternen und erklärte, dass ihre „Grafik neue Maßstäbe für Computerspiele gesetzt hat“. Das Magazin lobte die „atemberaubende“ Animation und die „beeindruckende“ Farbe, hoffte jedoch, dass zukünftige Cinemaware-Spiele das „angemessene“ Gameplay verbessern würden, das „das schwache Glied“ war.[5]Der australische Commodore Review gab der Commodore 64-Version des Spiels eine Gesamtpunktzahl von 96 von 100,[6] während Commodore-Benutzer sagte, dass es „total brillant und eines der besten Spiele auf dem 64.“ war.[7]Computerspielwelt lobte die Amiga-Version von Verteidiger der Krone ‚s Grafiken und Animationen, die das Spiel „ein Schaufensterprogramm nennen, um Ihren Freunden die Kraft des Amiga zu demonstrieren“. Obwohl das Gameplay nicht so komplex war wie bei anderen Strategiespielen der Zeit, war der Rezensent mit dem ersten Spiel von Cinemaware außerordentlich zufrieden.[8] In diesem Jahr gab die Zeitschrift Verteidiger der Krone eine besondere Auszeichnung für „künstlerische Leistung in einem Computerspiel“,[9] In den Jahren 1990 und 1993 gaben Umfragen zu Kriegsspielen in der Zeitschrift dem Spiel zwei von fünf Sternen.[10][11]

Berechnen! erklärte auch, dass Verteidiger der Krone demonstrierte effektiv die Grafik des Amiga, gab jedoch an, dass sein Gameplay zu stark vereinfacht wurde.[12]CU Amiga erklärte, dass „es nicht viele Bereiche gibt, in denen Verteidiger der Krone könnte verbessert werden … die Grafik ist raffiniert mit üppigen Farben und visuellen Effekten. „[13]Amiga-Format waren weniger freundlich zur CD-Neuveröffentlichung des Spiels und stellten fest, dass es „den Test der Zeit nicht bestanden hat, nur weil das Gameplay etwas schwach ist“.[14][1]

In 1996, Computerspielwelt erklärt Verteidiger der Krone das 92. beste Computerspiel, das jemals veröffentlicht wurde.[15]

Deckblattkunst[edit]

Das Cover von Verteidiger der Krone wurde von Peter Green Design zusammengestellt und von Ezra Tucker gemalt.

Randy McDonald war für die Art Direktion, das Design und die Produktion der ersten vier Spiele von Cinemaware verantwortlich und erklärt in einem Interview, dass „Peter Greene oder ich eine Skizze von allgemein machen würden, was wir für jedes Cover wollten. Ich ging zu Western Costume in Hollywood, das jahrzehntelang der Riese in der Kostümindustrie war, mietete Kostüme für die Art von „Look“, die wir für jedes Cover festgelegt hatten. Wir mieteten Models und brachten sie in Peters großes Fotostudio, wo wir sie aufstellten in den Kostümen, die ich gemietet hatte, so nah wie möglich an der Art und Weise, wie wir sie illustrieren wollten. „[16]

Der ursprüngliche Künstler sollte laut Randy McDonald Greg Winter sein, aber das Cover ging schließlich an Ezra Tucker.

Die Häfen von Verteidiger der KroneInsbesondere für DOS und NES führte dies zu einem enormen Verlust an Grafik- und Audioqualität, da diese Systeme im Vergleich zum Amiga schlechter abschneiden. Diese Ports enthielten jedoch detailliertere strategische Elemente als die unvollendete Originalversion. Der Apple IIGSDie Versionen Atari ST und Commodore 64 wurden mit besserem Erfolg portiert, die IIGSDie Grafiken der Versionen Macintosh und ST kommen der Amiga-Version sehr nahe. Eine Version für den Sharp X68000 wurde von Bullet-Proof Software entwickelt, aber nie veröffentlicht.[17]

Alle Ports:

1989 wurde das Spiel das zweite Spiel, das auf CD-ROM ausgeliefert wurde Das Mannloch.[21]

Remakes[edit]

Nach einer Reihe erfolgreicher Spiele und Spieleserien ging Cinemaware schließlich bankrott. Im Jahr 2000 kauften Lars Fuhrken-Batista und Sean Vesce jedoch den Namen und das Vermögen von Cinemaware und gründeten Cinemaware Inc., wobei sie ein Remake von nannten Verteidiger der Krone für moderne PCs als eines der ersten Projekte des reformierten Unternehmens. Die neue Version mit dem Titel Robin Hood: Verteidiger der Krone wurde 2003 für PlayStation 2 (30. September), Xbox (6. Oktober) und Windows (15. Oktober) veröffentlicht. Das neue Unternehmen erstellte auch „Digital Remastered Versions“ klassischer Cinemaware-Spiele, darunter Verteidiger der Krone.

Im Februar 2007 wurde eine Hommage an das Spiel genannt Verteidiger der Krone: Helden leben für immer wurde von eGames veröffentlicht,[22] der Cinemaware im Jahr 2005 erworben hatte. Helden leben für immer enthält viele Elemente des Originalspiels, darunter Turnier- und Bogenschießen-Turniere, Überfälle auf Burgen, Rettung von Prinzessinnen und Belagerung feindlicher Festungen per Katapult. Neu im Spiel war die Verwendung von Helden- und Taktikkarten während eines Kampfes, wodurch die Armee des Benutzers während des Nahkampfs auf dem Bildschirm verschiedene Verbesserungen erhielt.

Verteidiger der Krone II wurde 1993 von Commodore International für CDTV und Amiga CD32 veröffentlicht.

Die dänische Band PRESS PLAY ON TAPE hat die Titelmusik des Spiels neu gemischt und die Instrumentalmelodie durch mittelalterlich klingende Texte ersetzt.[23]

In der zweiten Hälfte der 1980er Jahre wurden einige Spiele direkt von inspiriert Verteidiger der Krone wurden freigelassen. Darunter war zum Beispiel Jeanne d’Arc (Rainbow Arts, 1989).

Verweise[edit]

  1. ^ ein b Maher, Jimmy (2015-04-16). „Verteidiger der Krone“. Der digitale Antiquar. Abgerufen 16. April 2015.
  2. ^ Am Rande: der spektakuläre Aufstieg und Fall von Commodore von WorldCat.org
  3. ^ Worley, Joyce (Dezember 1989). „Mega Hits: Die Besten der Besten“. Videospiele & Computerunterhaltung: 130–132, 137, 138.
  4. ^ Hill, Mark (Januar 2001). „Cinemaware Rückkehr von den Toten“. PC-Zone (98): 30.
  5. ^ Dunnington, Benn; Brown, Mark R.; Malcolm, Tom (Januar – Februar 1987). „Amiga Galerie“. Die Info. S. 90–95.
  6. ^ Gordon, Stephen; Watts, Shane (Februar 1987), „Defender of the Crown – Seiten-Scan im Amiga Magazine Rack, Ausgabe 2, abgerufen am 18. Dezember 2012
  7. ^ Patterson, Mark (August 1987) „Defender of the Crown“ – Seitenscan im Amiga Magazine Rack, abgerufen am 18. Dezember 2012.
  8. ^ Lee, Wyatt (Januar – Februar 1987). „Verteidiger der Krone“. Computerspielwelt. S. 36–37, 68–69.
  9. ^ „Computer Gaming World trifft Dragoncon ’87“. Computerspielwelt. Nr. 42. Dezember 1987. p. 62. Abgerufen 23. April 2016.
  10. ^ Brooks, M. Evan (Oktober 1990). „Computerstrategie und Kriegsspiele: Vor dem 20. Jahrhundert“. Computerspielwelt. p. 11. Abgerufen 16. November 2013.
  11. ^ Brooks, M. Evan (August 1993). „Wargame Survey Version 2.0“. Computerspielwelt. p. 128. Abgerufen 12. Juli 2014.
  12. ^ Randall, Neil (Juni 1987). „Verteidiger der Krone für Amiga“. Berechnen!. p. 60. Abgerufen 10. November 2013.
  13. ^ Keating, Fiona (Juli 1991), „Defender of the Crown“ – Seitenscan im Amiga Magazine Rack, abgerufen am 18. Dezember 2012
  14. ^ Noonan, Damien (Oktober 1992) „Defender of the Crown – Seiten-Scan im Amiga Magazine Rack, Ausgabe 39, abgerufen am 18. Dezember 2012
  15. ^ Mitarbeiter (November 1996). „150 beste (und 50 schlechteste) Spiele aller Zeiten“. Computerspielwelt (148): 63–65, 68, 72, 74, 76, 78, 80, 84, 88, 90, 94, 98.
  16. ^ So entstand das Cover in Defender of the Crown – Spelpappan.se
  17. ^ „BPS の 話“. jester.dw.land.to (auf Japanisch). Archiviert vom Original am 24.08.2016. Abgerufen 2020-04-01.
  18. ^ „Verteidiger der Krone iOS“.
  19. ^ „Cinemaware Classic Verteidiger der Krone bereit für Android“. Archiviert von das Original am 2016-07-16. Abgerufen 2014-04-26.
  20. ^ https://mag.mo5.com/actu/147685/defender-of-the-crown-et-treasure-island-dizzy-sur-atari-jaguar/
  21. ^ Sipe, Russell (November 1992). „3900 Spiele später …“ Computerspielwelt. p. 8. Abgerufen 4. Juli 2014.
  22. ^ Verteidiger der Krone: Helden leben für immer von eGames
  23. ^ „CDs“. Drücken Sie Play On Tape. Abgerufen 7. Mai 2018.

Externe Links[edit]


Tite Kubo – Wikipedia

Japanischer Manga-Künstler

Tite Kubo ((久保 帯 人, Kubo Taito, geboren am 26. Juni 1977) ist ein japanischer Manga-Künstler. Er ist bekannt für seine Manga-Serie Bleichen, die ab 2018 über 120 Millionen Exemplare im Umlauf hatte.[2][3]

Biografie[edit]

Kubo wurde am 26. Juni 1977 in der Präfektur Hiroshima geboren, wo sein Vater als Stadtratsmitglied arbeitete. In der Grundschule hatte er bereits beschlossen, Manga-Künstler zu werden,[4] aufgrund des Mangas lesen Heilige Seiya. Sein erster One-Shot war „Ultra Unholy Hearted Machine“, geschrieben für die Wöchentlicher Shōnen-Sprung in 1996.[5] Er schrieb seinen ersten Manga Zombiepulver, die auch in veröffentlicht wurde Wöchentlicher Shōnen-Sprung Es dauerte nur 27 Kapitel, bevor es im Jahr 2000 abgesagt wurde. Laut dem Kommentar des Autors befand sich Kubo in einem Zustand schwerer emotionaler Traumata, als er es schrieb.[6] Kubo erklärte später, dass er nicht an die wöchentliche Serialisierung des Magazins gewöhnt sei und eher auf die Kommentare seines Herausgebers als auf seine eigenen Ideen geachtet habe.[7]

Seine nächste Serie, Bleichenüber einen Schüler, der a Shinigami und kämpft gegen Kreaturen, die als Hollows bekannt sind, und begann 2001 in derselben Zeitschrift zu laufen. Kubo erwartete zunächst, dass die Serialisierung der Serie nicht länger als fünf Jahre dauern würde.[5] Das ursprüngliche Story-Konzept wurde eingereicht Wöchentlicher Shōnen-Sprung kurz nach der Absage von Zombiepulverwurde aber abgelehnt. Akira Toriyama, Schöpfer von Dragon Ball, sah die Geschichte und schrieb einen Ermutigungsbrief an Kubo.[5]Bleichen lief für 15 Jahre Serialisierung und erreichte von 2001 bis 2016 über 686 Kapitel. Zusätzlich wurde eine Anime-Adaption der Serie von 2004 bis 2012 für 8 Jahre im TV Tokyo ausgestrahlt, die über 366 Folgen umfasste. Der Manga wurde 2004 für seine Kategorie als Gewinner des Shogakukan Manga Award ausgezeichnet.[8] Kubo und Makoto Matsubara haben zwei Romane des Bleichen Serien, die von Shueisha unter ihrer veröffentlicht wurden Sprungbücher Etikette.[9][10] Der Erste Bleichen Der Film wurde am 16. Dezember 2006 in Japan veröffentlicht, gefolgt von einem zweiten Film am 22. Dezember 2007, einem dritten am 13. Dezember 2008 und einem vierten am 4. Dezember 2010. Kubo erschien auch in der Folge 112 des japanischen Radios Programm von B-Station bleichen. In diesem Programm wurde Kubo von Masakazu Morita, Synchronsprecher von Ichigo Kurosaki, der Hauptfigur von, interviewt Bleichenund beantwortete mehrere Fragen von Fans.[11] Am 26. Juli 2008 reiste Kubo zum ersten Mal in die USA und trat auf der San Diego Comic-Con International auf.[12]

Kubo lieferte Charakterdesigns für Madhouses Anime-Adaptionen von Ango Sakaguchi Sakura no Mori no Mankai no Shita, Ryūnosuke Akutagawa Der Faden der Spinne, und Höllenbildschirm von Ryūnosuke Akutagawa, die Teile der Aoi Bungaku Serie.[13] Im Jahr 2018 kehrte Kubo zu Wöchentlicher Shōnen-Sprung und veröffentlichte einen One-Shot, Verbrenn die Hexezum Gedenken an das 50-jährige Bestehen des Magazins.[14] Später, im Jahr 2020, wurde der One-Shot in der Zeitschrift mit einem saisonalen Veröffentlichungsplan serialisiert.[15] Die erste Staffel mit 4 Kapiteln wurde von August bis September 2020 veröffentlicht.[16] Eine zweite Staffel der Serie wurde angekündigt.[17][18]

Beide serialisierten Werke von Kubo sind Shōnen Manga mit einem starken Fokus auf Action. Seine Kampfszenen zeichnen sich durch schnelle Schnitte und dramatische Winkeländerungen zwischen den Panels sowie durch die minimale Einbeziehung von Hintergrundgrafiken oder Begrüßungsseiten aus. Als Charakterdesigner hielt Kubo an einem unverwechselbar eckigen und schlaksigen Stil fest Zombiepulver und die frühen Teile von Bleichen, die etwas ausgefüllt als Bleichen Fortsetzung. Seine Entwürfe enthalten oft Elemente des Körperhorrors.[19][20][21]

Einflüsse[edit]

Tite Kubos frühester Einfluss stammt von Shigeru Mizukis Manga Gegege kein Kitaro. Er erinnert sich an den Versuch, seine Charaktere zu skizzieren, und fand seine eigenen Entwürfe einfacher als die von Mizuki.[7]Bleichen wurde zuerst aus dem Wunsch Kubos heraus entworfen, zu zeichnen Shinigami im Kimono, der die Grundlage für das Design des Shinigami in der Serie bildete, und die Konzeption des Charakters Rukia Kuchiki.[22] Kubo hat Einflüsse für Elemente von zitiert Bleichen von anderen Manga-Serien bis hin zu Musik, Fremdsprache, Architektur und Film. Er schreibt sein Interesse daran, das Übernatürliche und die Monster zu zeichnen, Shigeru Mizukis zu GeGeGe no Kitaro und Bleichens Fokus auf interessante Waffen- und Kampfszenen für Masami Kurumada Heilige SeiyaBeide Manga Kubo genossen als Junge.[22] Kubo erklärte, dass Akira Toriyama Dragon Ball lehrte ihn, dass alle Bösewichte ausnahmslos „stark, beängstigend und cool“ sein müssen, und fügte hinzu, dass ihn bis heute keine Kampfszene mehr schockiert hat als Trunks erster Auftritt.[23] Der Action-Stil und das Geschichtenerzählen in Bleichen sind vom Kino inspiriert, obwohl Kubo keinen bestimmten Film als Einflussfaktor für Kampfszenen offenbart hat.[24] Kubo hat auch erklärt, dass er machen möchte Bleichen Eine Erfahrung, die nur durch das Lesen von Manga gefunden werden kann, und abgelehnte Ideen, Live-Action-Filmadaptionen der Serie zu erstellen.[25]

Bei der Erstellung von Kampfszenen kommentiert Kubo, dass er sich die Kämpfe mit den leeren Hintergründen vorstellt und dann versucht, den besten Winkel dafür zu finden.[26] Dann versucht er, die Verletzungen sehr realistisch erscheinen zu lassen, damit die Leser den Schmerz des Charakters spüren.[27] Kubo erwähnt, dass er sich manchmal langweilt, wenn er sie illustriert, und versucht, ein paar Witze hinzuzufügen, um es humorvoller zu machen.[26] Beim Erstellen von Charakteren versucht Kubo zunächst, das Design zu erstellen und später zu entscheiden, wie die Persönlichkeit des Charakters gemäß seiner Zeichnung aussehen soll. Seit Kubo sie so erschafft, betrachtet er jeden Charakter als einzigartig und möchte, dass jeder von ihnen entlang der Serie entwickelt wird.[28] Auf die Frage nach romantischen Beziehungen zwischen bestimmten Charakteren antwortet Kubo, dass er die Serie nicht in eine Liebesgeschichte verwandeln möchte, da er der Meinung ist, dass es aufregendere Aspekte in Bezug auf ihre Persönlichkeit gibt.[29] Während die Angriffe und das Arsenal der Soul Reapers japanische Namen haben, verwenden andere Charaktere aus der Serie auch andere Sprachen, um ihre Begriffe zu beschreiben: deutsche Wörter für Kräfte aus der Quincy und Englisch für die Mitglieder von X-Cution. Im Fall der Hollows und Arrancars verwendet Kubo spanische Begriffe für ihre Fähigkeiten, da er sich für die spanische Sprache interessiert, um aus seiner Sicht „bezaubernd“ und „sanft“ zu klingen.[30]

Ein Schuss[edit]

Vor der Serienveröffentlichung schrieb und illustrierte Tite Kubo mehrere One-Shot-Mangas. Drei davon wurden später in englischer Sprache veröffentlicht und in den von Viz Media gesammelten Bänden von Zombiepulver. Diese kurzen Mangas zeigen die rasante Entwicklung von Kubos Kunststil Mitte der 90er Jahre. Danach veröffentlichte Kubo einen weiteren One-Shot Bleichen endete mit einem Kunststil, der weithin als sein eigener anerkannt wurde.

  • Ultra unheilige Maschine (1996, Wöchentlicher Shōnen-Sprung, Shueisha.) Krimis. Kubos erster veröffentlichter Manga, seine markanten eckigen Designs fehlen.[20]
  • Runenmeister Urara (1996, Wöchentlicher Shōnen-Sprung, Shueisha.) Fantasie. Hat raue Kunst und einen Zwischenstil.[19]
  • Bad Shield United (1997, Wöchentlicher Shōnen-Sprung, Shueisha.) Sci-Fi. Die Charakterästhetik, die sich durchgesetzt hat Zombiepulver. und die frühen Bögen von Bleichen sind hier in vollem Beweis.[20]
  • Verbrenn die Hexe (2018, Wöchentlicher Shōnen-Sprung, Shueisha.) Übernatürlich. Kubos One-Shot danach Bleichen beendet.[31]

Serie[edit]

Zunächst erscheint in Wöchentlicher Shōnen-Sprung Der Manga wurde von Shueisha in Tokio, Japan, veröffentlicht und in Nordamerika von Viz Media lizenziert.

  • Zombiepulver. (1999–2000, Wöchentlicher Shōnen-SprungShueisha. In 4 Bänden gesammelt.)
  • Bleichen (2001–2016, Wöchentlicher Shōnen-SprungShueisha. In 74 Bänden gesammelt.)
  • Verbrenn die Hexe (2020 – heute, Wöchentlicher Shōnen-SprungShueisha. In 1 Band gesammelt.)

Artbooks[edit]

  • Bleichen Sie alle Farben außer dem Schwarz[32]
  • Bleach Official Bootleg[33]
  • JET bleichen[34]

Datenbücher[edit]

  • Bleach Official Character Book SOULs[35]
  • Bleach Official Anime Guide Book VIBEs[36]
  • Bleach Official Character Book 2 MASKED[37]
  • Bleach Official Character Book 3 UNMASKED[38]
  • Bleiche 13 BLADEs.[39]

Videospiele[edit]

Verweise[edit]

  1. ^ „Tite Kubo hat geheiratet“. Anime News Network. 2012-12-22.
  2. ^ „Shueisha Media Guide 2013: Comic-Magazine für Jungen und Männer“ (PDF) (auf Japanisch). Shueisha. Archiviert von das Original (PDF) am 04.04.2014. Abgerufen 2013-12-27.
  3. ^ Offizieller Film „BLEACH“ (5. Februar 2018). „\\7⃣ 月 2⃣0⃣ 日 公開 決定 // 全世界 で シ リ 累計 累計 1 億 2000 万 部 を 超 る 超人 気 コ ミ ッ 原作 悪〉 ACH ACH ACH ACH LE LE LE LE LE LE LE LE LE LE LE LE LE LE LE 』の 公開 日 が 月 7 月 20 日 (()) 決定“. Twitter. Abgerufen 5. Februar 2018.
  4. ^ http://manga.about.com/od/mangaartistinterviews/a/TiteKubo.htm
  5. ^ ein b c Charles Solomon (28. August 2008). „Creator Tite Kubo überrascht vom Erfolg von ‚Bleach'“. Los Angeles Zeiten. Archiviert von das Original am 23. April 2009. Abgerufen 17. September, 2008.
  6. ^ Kubo, Tite (2000). Zombie Powder vol. 03. Shueisha. Kommentar des Autors. ISBN 4-08-872877-7.
  7. ^ ein b Kido, Misaki C. (Februar 2012). „Interview mit Tite Kubo (Schöpfer von Bleach)“. Wöchentlicher Shonen Jump Alpha. Viz Media (2–20–12): 124–126.
  8. ^ 小学 館 漫画 賞: 歴 代 受 賞 賞 (auf Japanisch). Shogakukan. Abgerufen 2007-08-19.
  9. ^ „Bleach Romanreihe“ (auf Japanisch). Shueisha. Abgerufen 2008-04-15.
  10. ^ „Bleach Romanreihe“ (auf Japanisch). Shueisha. Abgerufen 2008-04-15.
  11. ^ Tite Kubo, Masakazu Morita (August 2007). Tite Kubo Interview, Bleach B-Station 112. Japan: B-Station bleichen.
  12. ^ „Comic-con 2008 Gäste“. Comic-Con International. Archiviert von das Original am 24.07.2009. Abgerufen 2009-12-12.
  13. ^ „Madhouse’s Aoi Bungaku postet Mitarbeiter, Besetzungsaufstellung“. Anime News Network. 2009-09-22. Abgerufen 2014-09-26.
  14. ^ Pineda, Rafael Antonio (27. Juni 2018). „Bleachs Tite Kubo enthüllt ‚Burn the Witch‘ 1-Shot Manga“. Anime News Network. Abgerufen 18. März, 2020.
  15. ^ Martinez, Phillip (18. März 2020). „“BLEACH ‚ANIME, 2021 zurückzukehren; ‚BURN THE WITCH‘ ERHÄLT SERIALISIERUNG UND ANIME „. Newsweek. Abgerufen 18. März, 2020.
  16. ^ Hodgkins, Crystalyn (10. August 2020). „Tite Kubos 4-Kapitel-Debüt“ Burn the Witch Manga „am 24. August“. Anime News Network. Abgerufen 10. August 2020.
  17. ^ UR 帯 人 「VERBRENNEN SIE DIE HEXE Season 単 行 本 の 発 売 & Staffel2 の 制作 が 決定. Natalie (auf Japanisch). 14. September 2020. Abgerufen 14. September 2020.
  18. ^ Pineda, Rafael Antonio (13. September 2020). „Bleachs Tite Kubo enthüllt Entwurfsseiten für Burn the Witch ‚Season 2‘ Manga“. Anime News Network. Abgerufen 14. September 2020.
  19. ^ ein b Theron Martin (2007-03-01). „Zombie Powder GN 3“. Anime News Network. Abgerufen 2008-09-12.
  20. ^ ein b c Schneewildschmied (2008-01-31). „Zombie-Pulver“. TeenReads.com. Archiviert von das Original am 14.08.2014. Abgerufen 2014-08-14.
  21. ^ „Bleichmittel GN 48-49“. Anime News Networkauthor = Santos, Carlo. 2012-11-02. Abgerufen 2014-08-15.
  22. ^ ein b Deb Aoki. „Interview: Tite Kubo (Seite 1)“. About.com. Abgerufen 2008-09-16.
  23. ^ Suzuki, Haruhiko, hrsg. (2003-12-19). „5: Dragon Ball Children“. Dragon Ball Landmark (auf Japanisch). Shueisha. p. 172. ISBN 4-08-873478-5.
  24. ^ Shonen Jump # 51. Band 5, Ausgabe 3. März 2007. Viz Media. 328.
  25. ^ Shonen Jump # 39. Band 4, Ausgabe 3. März 2006. Viz Media. 010.
  26. ^ ein b Deb Aoki. „Interview: Tite Kubo (Seite 3)“. About.com. Abgerufen 2008-09-16.
  27. ^ Kai-ming Cha (04.08.2008). „Kubo kommt zur Comic-Con“. Publishers Weekly. Abgerufen 2008-09-17.
  28. ^ Anime Insider. Wizard Universe (61): 39. Oktober 2008. ISSN 1547-3767.
  29. ^ Deb Aoki. „Interview: Tite Kubo (Seite 2)“. About.com. Abgerufen 2008-09-16.
  30. ^ Shonen Jump. Band 6, Ausgabe 6. Juni 2008. Viz Media. 12.
  31. ^ Rafael Antonio Pineda (28.06.2018). „Bleachs Tite Kubo enthüllt ‚Burn the Witch‘ 1-Shot Manga“. animenewsnetwork.com. Abgerufen 2018-06-28.
  32. ^ „BLEACH イ ラ ス ト 集 Alle Farben außer dem Schwarz“ (auf Japanisch). Shueisha. Abgerufen 2008-04-27.
  33. ^ „BLEICHEN SIE OFFIZIELLEN BOOTLEG リ ラ ラ リ + | 久保 帯 人 | ジ ャ ン プ コ ミ ッ ク ス“ (auf Japanisch). Shueisha. Abgerufen 2008-04-27.
  34. ^ „“Bleach kündigt massive Kunstsammlung an „. Comicbook.com. Abgerufen 2018-06-12.
  35. ^ „BLEACH― ブ リ ー チ – OFFIZIELLE CHARAKTERBUCHSEELEN“ (auf Japanisch). Shueisha. Abgerufen 2008-04-27.
  36. ^ „BLEACH― ブ リ ー チ – OFFIZIELLE ANIMATION BOOK VIBEs“ (auf Japanisch). Shueisha. Abgerufen 2008-04-27.
  37. ^ „BLEACH― ブ リ ー チ – OFFIZIELLES CHARAKTERBUCH 2 MASKIERT“ (auf Japanisch). Shueisha. Abgerufen 06.08.2010.
  38. ^ „BLEACH― ブ リ ー チ – OFFIZIELLES CHARAKTERBUCH 3 UNMASKIERT“ (auf Japanisch). Shueisha. Abgerufen 10.08.2015.
  39. ^ „BLEICHEN SIE 13 BLÄTTER. ブ リ ー チ 13 ブ レ イ ズ“ (auf Japanisch). Shueisha. Abgerufen 10.08.2015.

Externe Links[edit]


Die Ameise und der Grashüpfer

Die Ameise und der Grashüpfer
Die Ameise und die Heuschrecke von Charles H. Bennett.jpg

Die Heuschrecke bittet an der Tür der Ameise. Kunst von Charles H. Bennet (1857).

Volksmärchen
Name Die Ameise und der Grashüpfer
Auch bekannt als Die Heuschrecke und die Ameise (373 im Perry Index of Fables)
Daten
Aarne-Thompson-Gruppierung ATU 280A (Die Ameise und das Cricket)
Region Griechenland
Veröffentlicht in Fabeln des Äsopvon Aesop

Die Ameise und der Grashüpfer, alternativ betitelt Die Heuschrecke und die Ameise (oder Ameisen) ist eine von Aesops Fabeln, die im Perry-Index mit 373 nummeriert ist.[1] Die Fabel beschreibt, wie eine hungrige Heuschrecke im Winter um Nahrung von einer Ameise bittet und abgelehnt wird. Die Situation fasst moralische Lehren über die Tugenden harter Arbeit und Zukunftsplanung zusammen.[2]

Sogar in der klassischen Zeit wurde der Rat jedoch misstrauisch und eine alternative Geschichte stellte die Ameisenindustrie als gemein und eigennützig dar. Jean de la Fontaines zart ironische Nacherzählung auf Französisch erweiterte später die Debatte, um die Themen Mitgefühl und Nächstenliebe zu behandeln. Seit dem 18. Jahrhundert gilt die Heuschrecke als Typ des Künstlers, und auch die Frage nach dem Platz der Kultur in der Gesellschaft wurde berücksichtigt. Die Auseinandersetzung mit der ambivalenten Bedeutung der Fabel wurde im Allgemeinen durch Anpassung oder Neuinterpretation der Fabel in Literatur, Kunst und Musik geführt.

Fabel und Gegenfabel[edit]

Die Fabel handelt von einer Heuschrecke (im Original eine Zikade), die den Sommer mit Singen verbracht hat, während die Ameise (oder in einigen Versionen Ameisen) daran arbeitete, Lebensmittel für den Winter aufzubewahren. Wenn diese Jahreszeit kommt, stirbt die Heuschrecke vor Hunger und bittet die Ameise um Nahrung. Die Ameise tadelt jedoch ihre Untätigkeit und fordert sie auf, den Winter jetzt wegzutanzen.[3] Versionen der Fabel finden sich in den Verssammlungen von Babrius (140) und Avianus (34) sowie in mehreren Prosasammlungen, einschließlich jener, die Syntipas und Aphthonius von Antiochia zugeschrieben werden. Die griechische Originalzikade der Fabel wird in lateinischen und romanischen Übersetzungen aufbewahrt. Eine variante Fabel, im Perry Index separat mit 112 nummeriert,[4] kennzeichnet einen Mistkäfer als das improvisierte Insekt, das feststellt, dass der Winterregen den Mist wegwäscht, von dem es sich ernährt.

Die Fabel findet sich in einer Vielzahl mittelalterlicher lateinischer Quellen und gilt auch als moralische Ballade unter den Gedichten von Eustache Deschamps unter dem Titel La fourmi et le céraseron.[5] Von Anfang an setzt es Vorkenntnisse der Fabel voraus und präsentiert menschliche Beispiele für vorsehendes und improvisiertes Verhalten, wie es die Insekten charakterisieren. Einige neo-lateinische Dichter tauchten nicht nur in einheimischen Sammlungen von Aesops Fabeln in der Renaissance auf, sondern verwendeten es auch als Thema, darunter Gabriele Faerno (1563).[6]Hieronymus Osius (1564)[7] und Candidus Pantaleon (1604).[8]

Die Geschichte wurde verwendet, um die Tugenden harter Arbeit und die Gefahren der Improvisation zu lehren. Einige Versionen geben am Ende eine Moral nach dem Motto „Eine müßige Seele wird Hunger leiden“ an.[9] „Heute arbeiten, um morgen zu essen“,[10] und „Juli folgt bis Dezember“.[11] In La Fontaines Fabeln wird kein endgültiges Urteil gefällt,[12] obwohl argumentiert wurde, dass der Autor da ist und sich über seine eigenen notorisch improvisierten Wege lustig macht.[13] Aber der Standpunkt in den meisten Nacherzählungen der Fabel unterstützt die Ameise. Es wird auch durch die Belobigung im biblischen Buch der Sprüche beeinflusst, in der die Ameise zweimal erwähnt wird. Das erste Sprichwort mahnt: „Geh zur Ameise, du Fauler! Betrachte ihre Wege und sei weise, die keinen Kapitän, Aufseher oder Herrscher hat, ihre Vorräte im Sommer liefert und ihr Essen in der Ernte sammelt“ (6.6-9). . Später, in einem parallelen Spruch von Agur, gehören die Insekten zu den vier Dingen, die auf der Erde wenig sind, aber überaus weise. Die Ameisen sind ein Volk, das nicht stark ist, aber im Sommer ihr Essen liefert. ‚ (30,24-5)

Es gab jedoch eine alternative Tradition, die auch Aesop zugeschrieben wurde, in der die Ameise als schlechtes Beispiel angesehen wurde. Dies erscheint als Gegenfabel und ist im Perry-Index mit 166 nummeriert.[14] Es berichtet, dass die Ameise einst ein Mann war, der immer mit der Landwirtschaft beschäftigt war. Er war mit den Ergebnissen seiner eigenen Arbeit nicht zufrieden und plünderte nachts die Ernte seiner Nachbarn. Dies verärgerte den König der Götter, der ihn zu einer Ameise machte. Obwohl der Mann seine Form geändert hatte, änderte er seine Gewohnheiten nicht und geht bis heute auf den Feldern herum, um die Früchte der Arbeit anderer Menschen zu sammeln und sie für sich aufzubewahren. Die Moral, die der Fabel in altgriechischen Quellen gegeben wurde, war, dass es einfacher ist, das Aussehen zu ändern, als die moralische Natur eines Menschen zu ändern. Es ist seit der klassischen Zeit selten bemerkt worden. Zu den wenigen prominenten Fabelsammlern, die es später aufzeichneten, gehörten Gabriele Faerno (1564),[15] und Roger L’Estrange (1692).[16] Letzterer kommentiert, dass die „Vertue and Vice“ der Ameise in vielen Fällen kaum zu unterscheiden sind, sondern nur durch den Namen.

Wegen des Einflusses von La Fontaines Fabeln, in denen La cigale et la fourmi Am Anfang stand die Zikade dann das sprichwörtliche Beispiel für Improvisation in Frankreich: so sehr, dass Jules-Joseph Lefebvre (1836–1911) ein Bild von einem weiblichen Akt malen konnte, der einen ihrer Nägel zwischen die fallenden Blätter beißt, und sicher sein konnte Die Zuschauer würden den Punkt verstehen, indem sie ihm den Titel geben La Cigale. Das Gemälde wurde im Salon von 1872 mit einem Zitat aus La Fontaine ausgestellt. Quand la Bise Fut Veranstaltungsort (Als der Nordwind wehte) und wurde als Kritik an dem kürzlich abgesetzten Napoleon III angesehen, der die Nation in einen katastrophalen Krieg mit Preußen geführt hatte. Ein anderes mit dem gleichen Titel, alternativ bekannt als „Mädchen mit einer Mandoline“ (1890), wurde von Edouard Bisson (1856–1939) gemalt und zeigt einen Zigeunermusiker in einem ärmellosen Kleid, das im fallenden Schnee zittert.[17] Ebenfalls so genannt ist das Gemälde von Henrietta Rae (eine Schülerin von Lefebvre) eines nackten Mädchens mit einer Mandoline über dem Rücken, das zwischen den fallenden Blättern an der Wurzel eines Baumes kauert.[18]

Die Heuschrecke und die Ameise werden im Allgemeinen als Frauen dargestellt, da beide Wörter für die Insekten in den meisten romanischen Sprachen vom weiblichen Geschlecht sind. Die Heuschrecke als Musiker vorzustellen, der im Allgemeinen eine Mandoline oder Gitarre trägt, war eine Konvention, die entstand, als das Insekt als Mensch dargestellt wurde, da sich Sänger auf diesen Instrumenten begleiteten. Der Bildhauer und Maler Ignaz Stern (1679–1748) hat auch die Heuschrecke dünn gekleidet und zittert in den gepaarten Statuen, die er unter dem Titel der Fabel hergestellt hat, während die fröhliche Ameise wärmer gekleidet ist.[19] Aber der antiklerikale Maler Jehan Georges Vibert hat männliche Charaktere in seinem Bild von „La cigale et la fourmi„von 1875.[20] Es ist als mittelalterliche Szene gemalt, in der ein Minnesänger mit einer hohen Laute auf dem Rücken auf einem schneebedeckten Hochland auf einen Mönch trifft. Der warm eingehüllte Mönch hat Almosen gesammelt und könnte dem Musiker einen Vortrag über seine Improvisation halten. Im Gegensatz dazu stellt der Naturforscher Victor-Gabriel Gilbert (1847–1933) die Fabel als auf dem Marktplatz einer kleinen Stadt in Nordfrankreich inszeniert dar.[21] Eine ältere Stallwächterin sieht eine heruntergekommene Frau stirnrunzelnd an, die in der Nähe stehen geblieben ist, während ihr jüngerer Begleiter verzweifelt zuschaut. In seiner Lithographie aus der Volpini-Suite „Les cigales et les fourmis“ (1889) vermeidet Paul Gauguin ein Urteil. Mit dem Untertitel „Ein Andenken an Martinique“ wird eine Gruppe von Frauen dargestellt, die auf dem Boden sitzen oder liegen, während im Hintergrund andere Frauen mit Körben auf dem Kopf vorbeigehen.[22] Er ist zufrieden damit, dass sie das Verhalten veranschaulichen, das den Insekten sprichwörtlich ohne moralischen Kommentar zugewiesen wurde.

Lange Zeit konzentrierten sich die Illustratoren von Fabelbüchern eher auf die Darstellung von Winterlandschaften, wobei die Begegnung zwischen den Insekten nur den unteren Vordergrund einnahm. Im 19. Jahrhundert wuchsen die Insekten an Größe und nahmen menschliche Kleidung an. Es war diese Tendenz, die sich in dieser Neugier des Publizierens, dem 1894, reproduzierte Choix de Fables de La Fontaine, Illustrée par un Groupe des Meilleurs Artistes de Tokio, das in Japan gedruckt und von einigen der bedeutendsten Holzschnittkünstler des Tages illustriert wurde. Kajita Hankos Behandlung der Geschichte findet in einer typischen verschneiten Landschaft statt, in der sich die Grille einem strohgedeckten Häuschen nähert und von der gekleideten Ameise durch ein Fenster beobachtet wird.[23] Eine frühere chinesische Behandlung, die Mitte des Jahrhunderts von Baron in Auftrag gegeben wurde Félix-Sébastien Feuillet de Conches verwendet durch seine diplomatischen Kontakte menschliche Figuren, um die Situation darzustellen. Eine alte Frau in einem zerlumpten Kleid nähert sich der Dame des Hauses, die an ihrem Spinnrad auf einer offenen Veranda arbeitet.[24]

Die Verwendung der Insekten, um eine moralische Lehre zu ziehen, reicht bis ins 20. Jahrhundert. In Jean Vernons Bronzemedaille aus den 1930er Jahren kauert die Bittsteller-Zikade auf einem Ast, während sich die Ameise mit den Beinen um eine Bucheckerin nach unten erhebt.[25] Auf einer Seite ist die scharfe Antwort eingraviert. Vous chantiez, j’en suis fort aise./ Eh bien, dansez maintenant. (Sie haben gesungen? Ich bin froh, jetzt können Sie tanzen.) Jacob Lawrence zeigt in seiner Tuschezeichnung der Fabel von 1969 fast dieselbe Szene, jedoch mit einer anderen moralischen Absicht. Dort steht eine weinende Heuschrecke vor einer sitzenden Ameise, die nach hinten greift, um seine Abstellraumtür zu verschließen.[26] Es ist bemerkenswert, dass sich das künstlerische Gefühl inzwischen gegen die Ameise bewegt hat, mit der Erkenntnis, dass Improvisation nicht immer die einzige Ursache für Armut ist. Dennoch nutzte Ungarn die Fabel, um 1958 eine Sparkampagne auf einer 60-Forint-Briefmarke zu fördern.[27] Im folgenden Jahr erschien es erneut in einer Serie mit Märchen,[28] wie als einer von vielen Anhängern auf einer 1,50 tögrög Briefmarke aus der Mongolei.[29] In diesem Fall erinnerte die Hauptmarke an die Weltausstellung 1970 in Japan mit einem Bild des Sumitomo-Märchenpavillons.

Spätere Anpassungen[edit]

La Fontaines Darstellung der Ameise als fehlerhaften Charakter, verstärkt durch die Ambivalenz der alternativen Fabel, führte dazu, dass auch dieses Insekt als alles andere als ein Beispiel für Tugend angesehen wurde. Jules Massenets Ballett in zwei Akten Cigale, erstmals 1904 an der Opéra-Comique in Paris aufgeführt, porträtiert die Zikade als wohltätige Frau, die Mitleid mit „La Pauvrette“ (der armen Kleinen) hat. Aber La Pauvrette ist, nachdem er aufgenommen und gefüttert wurde, unhöflich und herzlos, wenn sich die Situation umkehrt. Cigale muss am Ende des Balletts im Schnee sterben.

Das Gedicht von La Fontaine wurde auch von mehreren französischen Parodien untergraben. In Joseph Autrans Réhabilitation de la fourmiDie Ameise hat zwar nur Stroh zum Essen, willigt aber ein, seine Vorräte mit der Zikade zu teilen, solange sie ihm ein Lied singt, das sie an den Sommer erinnert, der für ihn den Preis mehr als wert sein wird.[30]Tristan Corbière Ein Marcelle – le Poete et la Cigale ist eine unbeschwerte Literaturkritik an einem schlechten Dichter.[31] Im 20. Jahrhundert verwendet Jean Anouilh es als Grundlage für zwei fast unabhängige Fabeln. Im La fourmi et la cigale Die Ameise wird zu einer überarbeiteten Hausfrau, der der Staub ins Grab folgt. Die Zikade kommentiert, dass sie lieber ein Dienstmädchen anstellt.[32] Im La CigaleAnouilh beschäftigt sich mit der Realität des künstlerischen Lebens und betrachtet die Zikade als den Typ der Musikerin. In dieser Fabel tritt sie als Nachtclub-Sängerin auf, die einen Fuchs bittet, als ihre Agentin zu fungieren. Er glaubt, dass sie ein leichtes Opfer für seine Manipulationen sein wird, aber sie behandelt ihn mit solch frostiger Finesse, dass er anfängt, selbst zu singen.[33]Pierre Perrets 1990er Version im urbanen Slang verspottet die traditionellere Rolle der Zikade als gedankenlose „Königin der Hitparade“. Die Subversion liegt in der vierzeiligen Moral am Ende, in der er rät, es sei besser, ein Impresario als ein Darsteller zu sein.[34]

Roland Bacri nimmt die Geschichte mit seinem auf Neuland Fable Electorale.[35] Ein nicht gewählter Politiker aus finanziellen Mitteln besucht die Ameise und antwortete auf die Frage, was er bei den vergangenen Wahlen getan habe, dass er die Nationalhymne gesungen habe. Spielen mit den letzten Worten von La Fontaines Fabel (Eh bien, dansez Wartung) rät ihm der Industrielle, für den Präsidenten einzutreten (Präsidialwart). Auf der anderen Seite wendet Francoise Sagan die Satire gegen die zu fleißigen. Ihre Ameise hat den ganzen Winter über Vorräte und fordert die Heuschrecke auf, im Frühling in ihre Waren zu investieren. Aber die Bedürfnisse der Heuschrecke sind gering und sie rät stattdessen zu einem Rabattverkauf.[36] Um ein letztes Beispiel zu nennen: Die Anti-Krebs-Liga hat die Fabel in einen Angriff auf das Rauchen verwandelt. Der Appell der Heuschrecke, aus der Tasche und verzweifelt nach einer Zigarette, wird durch ein weiteres Stück am ursprünglichen Ende abgelehnt. Also hatte sie den ganzen Sommer geraucht? OK, jetzt husten (Et bien, toussez).[37]

Der englische Schriftsteller W. Somerset Maugham kehrt in seiner Kurzgeschichte „The Ant and The Grasshopper“ (1924) die moralische Ordnung auf andere Weise um. Es handelt sich um zwei Brüder, von denen einer ein zaghafter Verschwender ist, dessen hart arbeitender Bruder ständig aus Schwierigkeiten herauskommen muss. Am Ende ist letzterer wütend zu entdecken, dass sein ‚Grashüpfer‘-Bruder eine reiche Witwe geheiratet hat, die dann stirbt und ihm ein Vermögen hinterlässt.[38] Die Geschichte wurde später im Film angepasst Zugabe (1951) und die englische Fernsehserie Somerset Maugham Hour (1960).[39]James Joyce adaptiert die Fabel auch in eine Geschichte über brüderliche Konflikte in der Episode „The Ondt and the Gracehoper“ in Finnegans Wake (1939)[40] und macht von den Zwillingsbrüdern Shem und Shaun entgegengesetzte Tendenzen innerhalb der menschlichen Persönlichkeit:

Diese Zwillinge sind die Zwillinge, die ticken Homo Vulgaris.

In Amerika argumentiert John Ciardis poetische Kinderfabel „John J. Plenty and Fiddler Dan“ (1963) für Poesie über fanatische harte Arbeit. Ciaris Ameise, John J. Plenty, ist so sehr darauf aus zu retten, dass er sehr wenig von dem isst, was er gerettet hat. In der Zwischenzeit überleben Fiddler Dan, die Heuschrecke, und seine nicht konforme Ameisenfrau den Winter ohne Hilfe und spielen mit der Rückkehr des Frühlings wieder Musik.

Ambrose Bierce hat zwei Varianten der Geschichte in seinem Fantastische Fabel. In der ersten, „Die Heuschrecke und die Ameise“, nachdem die Ameise die Heuschrecke gefragt hat, warum sie keine Vorräte gemacht hat, antwortet sie, dass dies tatsächlich der Fall war, aber die Ameisen brachen ein und nahmen sie alle weg. In einem anderen, „Die Ameisen und die Heuschrecke“, ist die Heuschrecke ein Bergmann, der zu beschäftigt war, um sich vorzubereiten, während die Ameisen durch Politiker ersetzt werden, für die es seine Arbeit ist, die „gewinnlos amüsiert“.[41]

John Updikes Kurzgeschichte „Brother Grasshopper“ von 1987 handelt von zwei Schwägern, deren Leben parallel zur Fabel von Ameise und Heuschrecke verläuft. Einer, Fred Barrow, lebt eine konservative, zurückhaltende Existenz; Der andere, Carlyle Lothrop, gibt sein Geld verschwenderisch aus, insbesondere für gemeinsame Ferien für die Familien der beiden Männer, selbst wenn er finanziell zahlungsunfähig wird. Am Ende kommt jedoch eine unerwartete Umkehrung der archetypischen Rollen der Charaktere. Als Carlyle stirbt, stellt Fred, der jetzt geschieden und einsam ist, fest, dass er einen reichen Vorrat an Erinnerungen hat, der ohne die Größe seines Freundes nicht existiert hätte.

„Revolution“ (La Rivoluzione), ein Gedicht des italienischen kommunistischen Schriftstellers Gianni Rodari, bietet eine alternative politische Moral, indem es die Debatte über Pflicht, Mitgefühl und Utilitarismus durchbricht, die das Erbe von La Fontaines Fabel war. Er beschreibt, wie eine Ameise einer Zikade die Hälfte seiner Lebensmittel gibt. Diese Großzügigkeit ist die wahre Revolution![42] In Dmitry Bykovs Gedicht „Fable“ (Басня) Die Heuschrecke stirbt vor Kälte und träumt davon, dass die Ameise sie eines Tages im Himmel bitten wird, ihn an ihrem Tanz teilhaben zu lassen, worauf sie antworten wird: „Geh und arbeite!“[43]

Musikalische Einstellungen[edit]

La Fontaines Version der Fabel wurde von folgenden französischen Komponisten gesetzt:

  • Louis-Nicolas Clérambault, an den die Werke in der Fabelsektion von Nouvelles poésies spirituelles et morales sur les plus beaux airs (1730–37) wurden zugeschrieben. Der Text wird an die Melodie angepasst und mit einem neuen Titel versehen La fourmi et la sauterelle.[44]
  • Jacques Offenbach in Sechs Fabeln von La Fontaine (1842) für Sopran und kleines Orchester[45]
  • Charles Gounod, Part-Song für einen Cappella-Chor (1857)[46]
  • Benjamin Godard in Sechs Fabeln von La Fontaine für Gesang und Klavier (Op.17 c.1871)
  • Louis Lacombe, eingestellt auf 4 Männerstimmen (op. 88,2 1887)
  • Charles Lecocq in Sechs Fabeln von Jean de la Fontaine für Gesang und Klavier (1900)[47]
  • Camille Saint-Saëns in La cigale et la fourmi für Gesang und Klavier oder Orchester (um 1860)[48]
  • André Caplet herein Trois Fabeln von Jean de la Fontaine (1919) für Gesang und Klavier[49]
  • Paul-Marie Masson, für Gesang und Klavier (1926)
  • Maurice Delage in Deux Fabeln von Jean de la Fontaine (1931)[50]
  • Marcelle de Manziarly im Trois Fabeln von La Fontaine (1935) für Gesang und Klavier[51]
  • Jean-René Quignard für 2 Kinderstimmen
  • Charles Trenet trat 1941 mit Django Reinhardt und dem Hot Club de France auf[52]
  • Marie-Madeleine Duruflé (1921–99) als fünfte in ihr 6 Fabeln von La Fontaine für A-cappella-Frauenstimmen (1960)[53]
  • Claude Ballif, der erste von ihm Chansonettes: 5 Fabeln von La Fontaine für kleinen gemischten Chor (Op.72, Nº1 1995)
  • Ida Gotkovsky (1933-), die erste Fabel in Hommage an Jean de La Fontaine für gemischte Chöre und Orchester (1995)[54]
  • Jean-Marie Morel (1934-), eine kleine Kantate für Kinderchor und Streichquartett in La Fontaine en chantant (1999)
  • Isabelle Aboulker (* 1938), das vierte Stück in Femmes en Fabeln (1999) für hohe Stimme mit Klavier[55]

Es gab zwei Comic-Opern, die unter dem Titel standen La cigale et la fourmi im 19. Jahrhundert. Die von Ferdinand Poise war in einem Akt und datiert 1870. Die von Edmond Audran war in drei Akten und wurde 1886 in Paris, 1890 in London und 1891 in New York aufgeführt. Kurz darauf folgte die dunklere Stimmung von Jules Massenets Ballett Cigale, oben erwähnt. Spätere Anpassungen der Fabel an das Ballett schließen Henri Sauguets ein La cigale bei la fourmi (1941) und die dritte Folge in Francis Poulencs Les Animaux modèles (Modelltiere, 1941).[56] Im 21. Jahrhundert gab es „La C et la F de la F“, in dem die Tänzer mit dem Text interagieren, der von Herman Diephuis für Annie Sellems zusammengesetzte Darstellung der Fabeln im Jahr 2004 choreografiert wurde Film Les Fabeln à la Fontaine Regie führte Marie-Hélène Rebois im Jahr 2004.[57]

Der belgische Komponist Joseph Jongen setzte La Fontaines Fabel für Kinderchor und Klavier (op. 118, 1941) und den niederländischen Komponisten Rudolf Koumans Setzen Sie den französischen Text ein Vijf Fabels van La Fontaine (op. 25, 1964) für Schulchor und Orchester. Es gibt ein glücklicheres Ende in der Kinderoper des amerikanischen Komponisten Shawn Allen. Die Ameise und der Grashüpfer (1999). Am Ende dieser 30-minütigen Arbeit werden die beiden Insekten im Winter zu musikalischen Partnern, nachdem die Ameise die sterbende Heuschrecke wiederbelebt hat.[58]

Ivan Krylovs Variante der Fabel wurde 1851 von Anton Rubinstein für Gesang und Klavier eingestellt; eine deutsche Version (Der Ameise und die Libelle) wurde später in Leipzig im Jahr 1864 als Teil seiner veröffentlicht Fünf Fabeln (Op.64). Im folgenden Jahrhundert wurde der russische Text erneut von Dmitri Schostakowitsch in gesetzt Zwei Fabeln von Krylov für Mezzosopran, Frauenchor und Kammerorchester (op.4, 1922).[59] Eine ungarische Übersetzung der Fabel von Dezső Kosztolányi wurde 1977 auch für Mezzosopran, vierstimmigen gemischten Chor und 4 Gitarren oder Klavier von Ferenc Farkas eingestellt. Der katalanische Komponist Xavier Benguerel i Godó Setze die Fabel in seine 7 Fábulas de la Fontaine für die Rezitation mit Orchester im Jahr 1995. Diese verwendeten eine katalanische Übersetzung seines Vaters, des Schriftstellers Xavier Benguerel i Llobet [ca].[60]

Es gab auch rein instrumentale Stücke; Dazu gehört der erste von Antal Dorati 5 Stück für Oboe (1980)[61] und der erste von Karim Al-Zand Vier Fabeln für Flöte, Klarinette und Klavier (2003).[62]

Einstellungen der Aesop-Version waren viel seltener. Es war unter Mabel Wood Hill Aesops Fabeln durch Musik interpretiert (New York, 1920).[63] Es wurde 2009 auch in David Edgar Walthers ‚kurzen Opern-Dramen‘ aufgenommen. 2010 setzte Lefteris Kordis den griechischen Text als zweite Fabel in seinem „Aesop-Projekt“ für Oktett und Stimme.[64]

Moralische und künstlerische Debatte[edit]

Gustave Doré Illustration von La Fontaine Die Ameise und der Grashüpfer

La Fontaine folgt alten Quellen in seiner Nacherzählung der Fabel aus dem 17. Jahrhundert, in der die Ameise am Ende vorschlägt, dass die Heuschrecke, da sie den ganzen Sommer gesungen hat, jetzt zu ihrer Unterhaltung tanzen sollte.[65] Seine einzige direkte Kritik an der Ameise ist jedoch, dass es ihr an Großzügigkeit mangelte. Die Heuschrecke hatte um einen Kredit gebeten, den sie versprach, mit Zinsen zurückzuzahlen, aber „Die Ameise hatte einen Fehler, / Sie war keine Kreditgeberin“.

Die Leser seiner Zeit waren sich der christlichen Pflicht zur Nächstenliebe bewusst und spürten daher die moralische Zweideutigkeit der Fabel. Dies wird durch den Druck von Gustave Doré aus den 1880er Jahren weiter unterstrichen, der die Geschichte als menschliche Situation darstellt. Eine Musikerin steht an einer Tür im Schnee, und die Kinder des Hauses sehen sie mit Sympathie an. Ihre Mutter schaut von der Treppe herab. Ihre unermüdliche Industrie zeigt sich darin, dass sie weiter strickt, aber in einem Land, in dem die Strickfrauen (les tricoteuses) die Opfer der Guillotine während der Französischen Revolution verspottet hatte, wäre diese Aktivität auch mit mangelndem Mitleid verbunden gewesen.

Andere französische Fabulisten seit La Fontaine hatten bereits den Gegenangriff auf die selbstgerechte Ameise gestartet. Um 1800 lässt Jean-Jacques Boisard die Kritik der Ameise an seiner Lebensfreude mit der philosophischen These beantworten, dass wir alle am Ende sterben müssen, Horten ist Torheit, Genuss ist klug. In einer katholischen Bildungsarbeit (Fabeln, 1851) Jacques-Melchior Villefranche bietet eine Fortsetzung an, in der die Ameise ihre Vorräte verliert und die Biene um Hilfe bittet. Die frühere Verspottung der Ameise gegenüber der Heuschrecke ist jetzt auf sich selbst gerichtet:

Bist du hungrig? Na dann,
Eine Pirouette drehen,
Speisen Sie auf einer Mazurka,
Haben Sie Polka zum Abendessen.

Aber dann enthüllt die Biene, dass sie der Heuschrecke bereits Schutz gegeben hat und lädt die Ameise ein, sich ihm anzuschließen, seit ‚Alle, die leiden / verdienen, helfen gleichermaßen‘.

La Fontaines Fabel hatte auch eine Reihe von Übersetzungen ins Russische, von denen die meisten das Wort für die Heuschrecke sind strekoza. Obwohl dieses Wort heute eine Libelle bedeutet, könnte es zu der Zeit auch für eine Heuschrecke verwendet werden.[66]Ivan Krylovs bekanntester „Die Heuschrecke und die Ameise“ (Strekoza i muravej, 1808) folgt dem französischen Original genau,[67] aber in der 1782-Variante von Ivan Chemnitzer, einfach „The Grasshopper“ genannt, gibt es ein alternatives Ende. Dies kommentiert die letzten Worte der Ameise, dass sie nur gesprochen wurden, um der Heuschrecke eine Lektion zu erteilen, wonach die Ameise die Heuschrecke wirklich aus Mitleid fütterte.

Im 20. Jahrhundert betrat die Fabel die politische Arena. Walt Disneys Cartoon-Version, Die Heuschrecke und die Ameisen (1934)[68] konfrontiert das Dilemma des Umgangs mit Improvisation aus der Sicht von Franklin D. Roosevelts New Deal. Die Verantwortungslosigkeit der Heuschrecke wird durch sein Lied „Die Welt schuldet uns einen Lebensunterhalt“ unterstrichen, das später in diesem Jahr ein Hit von Shirley Temple wurde.[69] neu geschrieben, um die Geschichte des früheren Cartoons einzuschließen. Am Ende haben die Ameisen unter bestimmten Bedingungen Mitleid mit der Heuschrecke. Die Königin der Ameisen beschließt, dass die Heuschrecke bleiben darf, aber er muss seine Geige spielen, um sein Zimmer und seine Verpflegung zu erhalten. Er stimmt dieser Vereinbarung zu und lernt schließlich, dass er sich nützlich machen muss, und ändert seine Einstellung auf

Oh, ich schulde der Welt ihren Lebensunterhalt …
Sie Ameisen hatten Recht, als Sie sagten
Du musst für alles arbeiten, was du bekommst.[70]

In jüngster Zeit wurde die Fabel von beiden Seiten in der sozialen Debatte zwischen der Unternehmenskultur und denjenigen, die die Begünstigten als vorteilhaft betrachten, erneut politisch genutzt. In einer modernen satirischen Version der Geschichte, die ursprünglich 1994 geschrieben wurde, beruft die Heuschrecke zu Beginn des Winters eine Pressekonferenz ein, um sich über sozioökonomische Ungleichheit zu beschweren und das Haus der Ameise zu bekommen. Diese Version wurde von Pittsburghs Talkshow-Guru Jim Quinn geschrieben[71] als Angriff auf das Sozialprogramm der Clinton-Regierung in den USA. 2008 aktualisierte auch die konservative Kolumnistin Michelle Malkin die Geschichte[72] die Politik der „Barack Cicada“ zu satirisieren. Es wurden auch Anpassungen in andere Sprachen vorgenommen. Aber der Kommentar am Ende einer indischen Überarbeitung[73] erklärt solche sozialen Konflikte als Ergebnis einer selektiven Medienpräsentation, die Neid und Angst ausnutzt.

Die Fabel wurde in der Debatte um den Platz des Künstlers in der Arbeitsmoral gleichermaßen in den Dienst gestellt. In der mittelalterlichen Fassung von Marie de France hatte die Heuschrecke darauf hingewiesen, dass es ihre Aufgabe sei, „allen Kreaturen zu singen und Freude zu bereiten, aber ich finde niemanden, der mir jetzt dasselbe zurückgeben wird“. Die Antwort der Ameise ist jedoch durchaus materialistisch: „Warum sollte ich dir Essen geben / Wenn du mir keine Hilfe geben kannst?“[74] Ende des 15. Jahrhunderts macht Laurentius Abstemius in seiner ähnlichen Fabel von Mücke und Biene einen nützlichen Punkt, indem er verschiedene Insekten verwendet.[75] Die Mücke beantragt bei der Biene im Winter Nahrung und Schutz und bietet an, ihren Kindern im Gegenzug Musik beizubringen. Die Antwort der Biene ist, dass sie es vorzieht, den Kindern einen nützlichen Beruf beizubringen, der sie vor Hunger und Kälte bewahrt.

Die Fabel von „Ein Mücke und eine Biene“ sollte später von Thomas Bewick in seine 1818er Ausgabe von Aesops Fabeln aufgenommen werden. Die Schlussfolgerung, die er daraus zieht, lautet: „Die vielen unglücklichen Menschen, die wir täglich auf und ab singen sehen, um andere Menschen abzulenken, obwohl sie selbst sehr schwere Herzen haben, sollten alle, die die Erziehung von Kindern haben, warnen, wie notwendig es ist Um sie in Industrie und Wirtschaft zu bringen, sind ihre gegenwärtigen Aussichten so hoffnungsvoll. ‚[76] Die Künste werden vom französischen Revolutionär Pierre-Louis Ginguené nicht mehr hoch geschätzt, zu dessen „New Fables“ (1810) „The Grasshopper and the Other Insects“ gehören.[77] Dort ermahnt die Heuschrecke die anderen, seinem Beispiel unermüdlicher künstlerischer Tätigkeit zu folgen, und es wird geantwortet, dass die einzige Rechtfertigung für Poesie sein kann, wenn sie sozial nützlich ist.

Ein solcher Utilitarismus sollte bald von der Romantik in Frage gestellt werden, und seine Meisterschaft des Künstlers hat spätere Einstellungen geprägt. In den frühen Jahrzehnten des 20. Jahrhunderts sollte der rumänische Dichter George Topîrceanu in „Die Ballade einer kleinen Heuschrecke“ (Balada unui greier mic),[78] obwohl mehr in der Erzählung als durch völlige Moralisierung. Eine Grille verbringt den Sommer mit Singen; Der Herbst kommt, aber er fährt fort. Erst im eisigen Winter merkt das Cricket, dass er nicht für sich selbst gesorgt hat. Er geht zu seinem Nachbarn, der Ameise, um etwas zu essen zu bitten, aber die Ameise weigert sich zu sagen: „Du hast den ganzen Sommer deine Zeit verschwendet.“ Der englische Folksänger und Kinderschreiber Leon Rosselson dreht in seinem Lied aus den 1970er Jahren auf subtile Weise den Spieß um Die Ameise und der GrashüpferVerwenden Sie die Geschichte, um die selbstgerechte Ameise (und diese Menschen mit seiner Einstellung) zu tadeln, weil sie seine Mitgeschöpfe aus Mangel sterben lässt und weil sie blind für die Lebensfreude ist.[79]

Auf dem Gebiet der Kinderliteratur erzählen Slade und Toni Morrison die Fabel nach, Wer hat Spiel?: Die Ameise oder die Heuschrecke? (2003), wo die Heuschrecke den Handwerker darstellt, provoziert eine Diskussion über die Bedeutung von Kunst. Eine frühere Improvisation über die Geschichte, die Kunst und ihren Wert betrifft, wurde vom schlesischen Künstler Janosch unter dem Titel „Die Fiedelgrille und der Maulwurf“ geschrieben, der ursprünglich 1982 und 1983 in englischer Übersetzung veröffentlicht wurde.[80] Dort spielt die Grille den ganzen Sommer über zur Unterhaltung der Tiere, wird aber im Winter vom Hirschkäfer und der Maus abgelehnt. Sie trifft schließlich auf den Maulwurf, der ihre Musik liebt, besonders weil er blind ist. und lädt sie ein, bei ihm zu bleiben.[81]

Das Thema war in Leo Lionnis noch weiter entfernt behandelt worden Friedrich (1967). Hier konzentriert sich eine Feldmaus in einer Gemeinde, die sich eng darauf konzentriert, effizient für den Winter zu sammeln, stattdessen darauf, Eindrücke zu sammeln. Wenn die anderen Mäuse die Nützlichkeit in Frage stellen, besteht Frederick darauf, dass das Sammeln von Sonnenstrahlen für die kalten, dunklen Wintertage ebenfalls funktioniert. In der Tat erkennt die Gemeinde dies, nachdem das Essen aufgebraucht ist und die Moral niedrig ist, wenn es Fredericks Poesie ist, die ihre Stimmung hebt.[82]

Siehe auch[edit]

Verweise[edit]

  1. ^ Ben Edwin Perry (1965). Babrius und Phaedrus. Loeb Klassische Bibliothek. Cambridge, MA: Harvard University Press. S. 487, Nr. 373. ISBN 0-674-99480-9.
  2. ^ Brewers prägnantes Wörterbuch für Phrase und Fabel, Londoner Nachdruck 1992, S.36
  3. ^ Francisco Rodríguez Adrados, Geschichte der griechisch-lateinischen Fabel III, Leiden NL 2003, S.146
  4. ^ „Aesopica Website“. Mythfolklore.net. Abgerufen 2012-04-04.
  5. ^ Poésie Moral, Paris 1832, S. 191-2
  6. ^ Faerno, Gabriello (1743). Fabel 7. Abgerufen 2013-08-18.
  7. ^ „Fabel 88“. Uni-mannheim.de. Abgerufen 2013-08-18.
  8. ^ „Fabel 145“. Uni-mannheim.de. Abgerufen 2013-08-18.
  9. ^ Der Sonntagsschullehrer: Eine Monatszeitschrift, Chicago 1866, S.335
  10. ^ Debra J. Housel, Die Heuschrecke und die Ameisen – Reader’s Theatre Script & Fluency Lesson, 2014, S.9
  11. ^ Isaac Bickerstaffes Version, Das Gentleman’s Magazine, 26. November 1768, nachgedruckt in Der dramatische Schuster: Leben und Werk von Isaac Bickerstaff, Bucknell University 1972, S. 272-3
  12. ^ Jean de La Fontaine. „Originaltext und Übersetzung“. Bewilderingstories.com. Abgerufen 2013-08-18.
  13. ^ Andrew Calder, Die Fabeln von La Fontaine: Weisheit auf die Erde gebracht, Genf CH 2001, S. 18-24
  14. ^ „Zeus und die Ameise“, „Mythfolklore.net“. Mythfolklore.net. Abgerufen 2012-04-04.
  15. ^ Faerno, Gabriello (1743). Fabel LXXXIII, online verfügbar. Abgerufen 2012-04-04.
  16. ^ „Fabel 188“. Mythfolklore.net. Abgerufen 2012-04-04.
  17. ^ „IMENT.com“. IMENT.com. Abgerufen 2012-04-04.
  18. ^ Anzeigen auf Flickr
  19. ^ Kunstwert
  20. ^ Verfügbar auf Flickr
  21. ^ Česky. „WikiGallery“. WikiGallery. Abgerufen 2012-04-04.
  22. ^ „Paul Gauguin: Die Heuschrecken und die Ameisen: Ein Souvenir von Martinique aus der Volpini-Suite: Dessins lithographiques (22.82.2-4) | Heilbrunns Zeitleiste der Kunstgeschichte | Das Metropolitan Museum of Art“. Metmuseum.org. 09.08.2013. Abgerufen 2013-08-18.
  23. ^ „Online ansehen“. Abgerufen 2012-04-04.
  24. ^ „Online ansehen“. Abgerufen 2012-04-04.
  25. ^ „Creighton University“. Creighton.edu. Abgerufen 2013-08-18.
  26. ^ Hood Kunstmuseum, Hannover NH; Online ansehen
  27. ^ „Online ansehen“. Abgerufen 2012-04-04.
  28. ^ „Online ansehen“. Colnect.com. Abgerufen 2012-04-04.
  29. ^ „Online ansehen“. Abgerufen 2012-04-04.
  30. ^ Sonette capricieux von Autran, Joseph Antoine, 1813-1877
  31. ^ Les Amours Jaunes (Paris 1873), Text auf der French Classics Seite.
  32. ^ Der Text ist Version 4 dazu Website mit Lehrmitteln
  33. ^ Fabeln von Jean Anouilh, Paris, 1962. Der Text befindet sich in diesem Lehrdokument der Online Academy. S. 30-2
  34. ^ Le Petit Perret des Fables, Paris, 1990. Le Dictionnaire Argot Française
  35. ^ Le Canard Enchaîné 1995. Der Text befindet sich auf den Seiten 35-6 der Online Academy Lehrdokument
  36. ^ La Fourmi et la Cigale, Paris 2010. Der Text ist auf der Académie D’Aix Marseille Website
  37. ^ „L’univers des Fables, La Cigale, Le Tabac und La Fourmi“. Itereva.pf. Abgerufen 2013-08-18.
  38. ^ Maugham, Somerset: Gesammelte Kurzgeschichten Band 1, Geschichte 5
  39. ^ IMDB
  40. ^ III.1, S. 414-19, Finwake.com
  41. ^ Fantastische Fabeln, Seiten 164 und 188
  42. ^ Der italienische Text online
  43. ^ Aus seiner Sammlung Glückseligkeit, 2013
  44. ^ Die Partitur erscheint in John Metz, Die Fabeln von La Fontaine: Eine kritische Ausgabe des 18. JahrhundertsPendragon Press 1986, S.43
  45. ^ Performance
  46. ^ „Jean de La Fontaine – FRLT1800s Album – WRETCH“. Wretch.cc. Abgerufen 2013-08-18.
  47. ^ „Jean de La Fontaine – FRLT1800s Album – WRETCH“. Wretch.cc. Abgerufen 2013-08-18.
  48. ^ „Camille Saint-Saëns – La Cigale und La Fourmi“. hyperion-records.co.uk. Abgerufen 2013-08-18.
  49. ^ „Leistung bei“. Wretch.cc. Abgerufen 2012-04-04.
  50. ^ Eine Leistung auf Youtube
  51. ^ Online Wretch.cc Leistung
  52. ^ Video auf Youtube
  53. ^ Musimem
  54. ^ Der Chor tritt um 3.05 Uhr in diese Aufführung ein auf Youtube
  55. ^ Video auf Youtube
  56. ^ Die Musik ist zu hören auf Youtube
  57. ^ Arte TV-Archive
  58. ^ Margaret Ross Griffel, Opern auf Englisch: Ein Wörterbuch, Plymouth UK 2013, S.22
  59. ^ „Ein Kommentar und ein kurzer Auszug“. Exhaustiveshostakovich.wordpress.com. 2010-08-31. Abgerufen 2012-04-04.
  60. ^ Verfügbar auf Youtube
  61. ^ Verfügbar auf Youtube
  62. ^ „Die Punktzahl“ (PDF). Abgerufen 2012-04-04.
  63. ^ Die Partitur ist auf der verfügbar Standort der Rochester University
  64. ^ Aesop-Projekt – VIII. Der Fuchs und die Trauben – Lefteris Kordis Octet auf Youtube
  65. ^ Eine englische Übersetzung finden Sie unter Gutenberg
  66. ^ К истории русских литературных насекомых, Fjodor Uspenskij
  67. ^ Das russische Original und eine ungefähre englische Übersetzung von Sergey Kozlov erscheinen auf der Website des Russischen Universums
  68. ^ Verfügbar auf auf Youtube
  69. ^ Temple sang das Lied im Film Now and Forever. Verfügbar auf auf Youtube
  70. ^ „Lyricsdownload.com“. Lyricsdownload.com. Abgerufen 2012-04-04.
  71. ^ „Warroom.com“. Warroom.com. Archiviert von das Original am 20.04.2012. Abgerufen 2012-04-04.
  72. ^ Malkin, Michelle (26.09.2008). „Michellemalkin.com“. Michellemalkin.com. Abgerufen 2012-04-04.
  73. ^ Devang Vibhakar (05.03.2009). „Die Ameisen- und Heuschreckengeschichte – indische Version“. Speakbindas.com. Abgerufen 2012-04-04.
  74. ^ Das Original und seine Übersetzung erscheinen bei Web.kyoto-inet.or.jp
  75. ^ „Hecatomythium, Fabel 94“. Aesopus.pbworks.com. Abgerufen 2012-04-04.
  76. ^ „Fabel XVI“. Mythfolklore.net. Abgerufen 2012-04-04.
  77. ^ Fabel XXVI, S.139-40, französischer Text bei Google Bücher
  78. ^ Es gibt moderne musikalische Interpretationen, einschließlich einer von Sänger auf YouTube Mihai Constantinescu [ro] und eine Hip-Hop-Version auf Youtube
  79. ^ „Text“. Sniff.numachi.com. Abgerufen 2012-04-04.
  80. ^ ISBN 978-3257007091
  81. ^ Es gibt eine deutschsprachige Animation Verfügbar auf auf Youtube
  82. ^ Eine Lesung aus dem Buch weiter Youtube

Externe Links[edit]


Universität von Wales, Lampeter – Wikipedia

Universität von Wales, Lampeter

Prifysgol Cymru, Llanbedr Pont Steffan

Universität von Wales, Lampeter Wappen.png
Motto Gair Duw Goreu Dysg (Walisisch)

Motto auf Englisch

Das Wort Gottes ist das beste Lernen (oder Lehrer)
Aktiv 1822 (Charta 1828) –2010
Adresse

College Street
Lampeter
Ceredigion

,,,

Campus Ländlich
Farben Schwarz und Gold[1]

Logo Lampeter University.gif

Universität von Wales, Lampeter (Walisisch: Prifysgol Cymru, Llanbedr Pont Steffan) war eine Universität in Lampeter, Wales. 1822 gegründet und 1828 durch königliche Urkunde eingetragen,[2] Es war die älteste Einrichtung zur Vergabe von Abschlüssen in Wales mit begrenzten Befugnissen zur Vergabe von Abschlüssen seit 1852. Es war von 1972 bis zu seiner Fusion (gemäß seiner Charta von 1828) mit dem Trinity University College im Jahr 2010 ein selbstverwaltendes College der University of Wales, um das Universität von Wales Trinity Saint David.[3]

Die Universität wurde gegründet als St. David’s College ((Coleg Dewi Sant), werden St. David’s University College ((Coleg Prifysgol Dewi Sant) im Jahr 1971, als es Teil der Federal University of Wales wurde. Mit weniger als 2.000 Studenten auf dem Campus wurde es oft als eine der kleinsten öffentlichen Universitäten in Europa bezeichnet.

Geschichte[edit]

Als Thomas Burgess 1803 zum Bischof von St. David ernannt wurde, sah er die Notwendigkeit eines Colleges, an dem walisische Ordinanden eine höhere Ausbildung erhalten konnten. Die bestehenden Colleges in Oxford und Cambridge waren für die meisten angehenden Studenten nicht geografisch und finanziell geeignet.

Burgess hatte keine walisischen Verbindungen; Er wurde 1756 in Odiham, Hampshire, geboren. Nach seiner Ausbildung am Winchester College und am Corpus Christi College in Oxford hatte er kurze Aufenthalte in Salisbury und Durham, bevor er 1803 in sein erstes Bistum in Wales berufen wurde. Burgess beabsichtigte, sein neues College zu bauen trainiere Priester in Llanddewi Brefi, das zu dieser Zeit ähnlich groß war wie Lampeter, aber zehn Kilometer davon entfernt und mit einem Ehrenplatz in der christlichen Geschichte von Wales. Als Burgess 1820 bei seinem Freund, dem Bischof von Gloucester, wohnte, lernte er jedoch John Scandrett Harford kennen, einen reichen Landbesitzer aus Gloucestershire. Harford spendete das 12.000 m² große Castle Field-Gelände in Lampeter, benannt nach dem einst auf dem Feld enthaltenen normannischen Schloss. Dies ist der Ort, an dem die heutige Universität steht.

Gravur von Bischof Burgess

Ansicht des St. David’s College um 1835

St. David’s College wurde also etwas außerhalb von Lampeter gegründet; Der Grundstein wurde 1822 gelegt. Burgess verließ St. David 1825, um Bischof von Salisbury zu werden, aber die Arbeit am College wurde fortgesetzt, größtenteils unter Aufsicht von Harford. Die 16.000 Pfund, die für die Errichtung des Colleges erforderlich waren, wurden aus öffentlichen Spenden, einem staatlichen Zuschuss und vielbeachteten Geschenken aufgebracht, darunter eines von König George IV. Das Hauptgebäude des Colleges wurde 1827 fertiggestellt und das College wurde am St. David’s Day des Jahres offiziell eröffnet und begrüßte seine ersten 26 Studenten. Als solche war es die älteste Hochschule in Wales und die drittälteste in England und Wales, die 1828 ihre erste Charta erhielt. 1852 erhielt das College das Recht, den Bachelor of Divinity (BD) und zu verleihen 1865 wurde der Bachelor of Arts (BA) verliehen, lange bevor die anderen Colleges in Wales ihre eigenen Befugnisse zur Vergabe von Abschlüssen erlangten. Bereits 1865, als eine Kampagne zur Gründung einer Universität für Wales begonnen hatte, gab es Vorschläge, dass das College diese Funktion übernehmen sollte. Sie wurden jedoch von denen abgelehnt, die glaubten, dass es seinen ursprünglichen Zweck als theologische Hochschule beibehalten sollte.[4]

Obwohl es bis 1978 als Zentrum der Geistlichenausbildung bestand, gab es immer einen Teil der Studenten, die nicht ordiniert werden wollten. In der Charta von 1896 wurde ausdrücklich festgelegt, dass das College jeden akzeptieren kann, unabhängig davon, ob er beabsichtigt, heilige Befehle anzunehmen. Seit 1925 war es möglich, am College einen BA zu studieren, ohne überhaupt Theologie zu studieren. Während der gesamten Geschichte des Kollegiums waren Nicht-Ordinanden jedoch in der Minderheit. In den 1950er Jahren ging die Zahl der Ordinanden stark zurück, und das Kollegium stand vor einer möglichen Schließung, sofern es nicht die Finanzierung durch die Regierung sicherstellen konnte. Direktor JR Lloyd Thomas verschonte sich nicht im Kampf ums Überleben und 1960 erklärte sich das University College in Cardiff nach langen Verhandlungen bereit, Saint David’s zu sponsern. So begann die Regierung endlich, die DEZA finanziell zu unterstützen.

1971 wurde das College Mitglied der Federal University of Wales und setzte seine eigenen Befugnisse zur Vergabe von Studienabschlüssen aus. Es wurde St. David’s University College (SDUC). Zu diesem Zeitpunkt hatte das College begonnen, seine Fachgebiete zu verlagern, und obwohl die Theologie weiterhin eine Stärke war, konnten die Studenten aus einem viel breiteren Spektrum von Fächern der freien Künste wählen. 1996 stimmte der Geheimrat – als Antwort auf eine Petition der Universität – zu, seinen Titel erneut in den zu ändern Universität von Wales, Lampeter im Einklang mit Umzügen an anderen Orten der Universität und der Anerkennung ihres Wachstums und ihres sich ändernden Status. Im September 2007 wurde die Universität von Wales eher konföderaler als föderaler Natur, wodurch Lampeter den Status einer unabhängigen Universität erhielt. Im Gegensatz zu anderen ehemaligen Colleges in Wales blieb der Name der Institution jedoch unverändert.

Die Universität spezialisierte sich auf Theologie, Religionswissenschaft, Philosophie, Klassiker, Anthropologie, Archäologie, Englisch und Geschichte. Vor dem Zusammenschluss wuchs die Universität auch in Disziplinen der Geistes- und Sozialwissenschaften wie Film- und Medienwissenschaften, Studien der Informationsgesellschaft, Unternehmensführung, Chinesische Studien und Studien zum Freiwilligensektor. In den letzten zwei Jahrzehnten haben jedoch mehrere andere Abteilungen, die eigenständige Fächer unterrichteten, geschlossen, insbesondere Französisch, Deutsch und Geographie.

Die Universität verfügte über Forschungs- und Beratungsabteilungen, darunter das Zentrum für Überzeugungen und Werte, das Zentrum für Unternehmen, europäische Dienste und Beratungsdienste, archäologische Dienste und das Zentrum für das Studium der Religion in keltischen Gesellschaften.

In den frühen neunziger Jahren gab es am College auch eine einflussreiche Abteilung für Humangeographie. Dies wurde 2001 geschlossen, aber die Diaspora der Lampeter Geography School hat weiterhin Einfluss auf ihr Fachgebiet.

Im Jahr 2008 kam die Qualitätssicherungsagentur zu dem Schluss, dass die Qualität der Lampeter-Abschlüsse zwar zufriedenstellend war, sie jedoch „nur begrenztes Vertrauen“ in die Qualitätssicherungsverfahren und -systeme des Instituts hatten.[5] Im Anschluss an diese Einschätzung gab der Higher Education Funding Council für Wales einen weiteren Bericht in Auftrag, in dem „sehr reale Probleme der Führung und des Managements“ an der Universität festgestellt wurden.[6][7][8] Als direktes Ergebnis gab die Universität am 14. Dezember 2008 bekannt, dass sie Fusionsgespräche mit dem Trinity College in Carmarthen führt, um eine neue Universität in Wales zu gründen.[9] Im Juli 2010 wurde bekannt gegeben, dass die Königin einen Befehl zur Erteilung einer ergänzenden Charta an Lampeter genehmigt hatte, mit der die neue Universität von Wales, Trinity Saint David, gegründet und im September 2010 ihre ersten Studenten aufgenommen werden sollten[10] Zu diesem Zeitpunkt würde die Universität von Wales, Lampeter, offiziell aufhören zu existieren.

Universitätsgebäude[edit]

Das alte College[edit]

Das St. David’s Building an der Universität von Wales, Lampeter

CR Cockerell entwarf das ursprüngliche College, das jetzt als Saint David’s Building (altes Gebäude oder OB von Studenten) bezeichnet wird, in der Mitte des Campus. Es ist ein denkmalgeschütztes Gebäude[11] und enthält Hörsäle, Gemeinschaftsräume, Verwaltungsbüros, Studentenwohnheime und die folgenden drei Hauptbereiche:

Die alte Halle war das Refektorium, bis das Lloyd Thomas Building 1969 in Betrieb genommen wurde. Es wurde nicht mehr genutzt; Nach umfangreichen Restaurierungsarbeiten wurde es 1991 als einer der wichtigsten öffentlichen Räume für Tagungen, Abendessen, Konferenzen und zur Nutzung durch externe Organisationen wiedereröffnet. Es wurde auch für einige Untersuchungen verwendet.

In der Alten Halle befinden sich auch Gemälde verschiedener Auftraggeber, Präsidenten, Wohltäter und Vizekanzler et al. darunter Bischof Burgess, Maurice Jones, Thomas Price, Llewelyn Lewellin, Edward Harold Browne, Keith Robbins und Brian Robert Morris.

St. Davids Kapelle wurde 1827 geweiht. 1879 wurde es nach den Vorgaben des Architekten Thomas Graham Jackson aus Cambridge wieder aufgebaut. Es wurde am 24. Juni 1880 wiedereröffnet. In den 1930er Jahren wurde es erneut renoviert, hauptsächlich durch die Bereitstellung eines neuen Reredos im Jahr 1933 und eine umfassende Überholung der Orgel im Jahr 1934. Die Kapelle wurde mit einem eigenen Kaplan versehen und es wurden Gottesdienste abgehalten sonntags und die ganze Woche über sowie an Heiligen Tagen und großen Festen.

Die Gründerbibliothek beherbergte die Hauptbibliothek bis zur Eröffnung der neuen Bibliothek im Jahr 1966. Nach dieser Zeit beherbergte die Bibliothek die ältesten gedruckten Bücher (1470–1850) und Manuskripte der Universität (die frühesten ab dem 13. Jahrhundert), die Lampeter ab 1822 übergeben wurden, sowie die Archive der Universität. Es ist eine unbezahlbare Sammlung, die nur Lampeter bietet. Benannt nach seinen Gründern – Thomas Burgess (1756–1837), Thomas Bowdler (1754–1825) und Thomas Phillips (1760–1851) – diente es als Ressource für Forschung und Lehre, insbesondere in den Bereichen Englisch, Geschichte und Mittelalter. Im Jahr 2005 wurde angekündigt, auf dem Campus ein neues Bibliotheksgebäude für 700.000 GBP zu errichten, in dem die Spezialsammlungen der Universität untergebracht werden sollen, da die Gründerbibliothek für solche wertvollen Dokumente nicht umweltverträglich war. Diese Erweiterung der Hauptbibliothek wurde 2008 abgeschlossen.

Spätere Ergänzungen[edit]

Das ursprüngliche Canterbury-Gebäude

Das Canterbury-Gebäude wurde Ende des 19. Jahrhunderts für eine wachsende Zahl von Studenten gebaut. Der Grundstein wurde 1885 vom Erzbischof von Canterbury gelegt und das Gebäude am 24. Juni 1887 offiziell eröffnet. Es enthielt ein physikalisch-wissenschaftliches Labor, zwei Hörsäle und neue Unterkünfte. Strukturelle Probleme zwangen die Universität jedoch, das ursprüngliche Gebäude im Sommer 1971 abzureißen. Das zweite Canterbury-Gebäude wurde am 20. Oktober 1973 vom Vizekanzler der University of Kent eröffnet. Es wurde abgerissen und im Studienjahr 2012/13 durch das heutige Canterbury-Gebäude ersetzt.

Die Hauptbibliothek wurde am 7. Juli 1966 vom damaligen Kanzler der Universität von Wales, dem Herzog von Edinburgh, eröffnet. Es wurde erweitert und am 21. Juni 1984 vom Prinzen von Wales wiedereröffnet.

Das Kunstgebäude wurde von The Rt eröffnet. Hon Peter Thomas, Staatssekretär für Wales am 4. Oktober 1971, pünktlich zur Unterbringung der neuen Geographieabteilung. Die Abteilung für Archäologie und Anthropologie ist inzwischen in das Erdgeschoss des Gebäudes umgezogen. Der erste Stock wird von der Abteilung für Film und Medien sowie der Abteilung für Management und IT geteilt. Das Gebäude beherbergt jetzt die neue kombinierte AHA (Archäologie, Geschichte und Anthropologie). Abteilung.

Das Cliff Tucker Theater, am Ufer des Flusses Dulas, wurde 1996 von Sir Anthony Hopkins eröffnet und enthielt Unterrichtsräume, Hörsäle und einen großen Computerraum. Es wurde zu Ehren von Cliff Tucker, einem ehemaligen Studenten und Wohltäter der Universität, benannt.

Das Sheikh Khalifa GebäudeDas 1997 fertiggestellte und nach Sheikh Khalifa bin Zayed Al Nahyan, einem Wohltäter der Universität, benannte Institut beherbergte die Abteilung für Theologie, Religionswissenschaft und Islamwissenschaft, eine der größten Abteilungen dieser Art im Vereinigten Königreich. Es wurde von Professor Sir Stewart Sutherland eröffnet. Hinter dem Abteilungsgebäude befindet sich eine kleine Moschee, die von islamischen Studenten und Bewohnern der Stadt genutzt wird.

Das Roderic Bowen Forschungszentrum, fertiggestellt 2007 und benannt nach Roderic Bowen, einem ehemaligen Präsidenten der Universität, beherbergt die Sammlung und das Archiv der Gründerbibliothek und grenzt an das Hauptbibliotheksgebäude an. Das Zentrum wurde am 17. Oktober 2008 vom Ersten Minister für Wales, Rhodri Morgan, eröffnet.

Das Konfuzius-Institut Es wurde 2007 als Sitz der Abteilung für Chinesische Studien der Universität eröffnet und hatte direkte Verbindungen zu chinesischen Kulturinstituten.

Archäologische Laboratorien Bereitstellung von Einrichtungen für Umweltarchäologie, Osteoarchäologie, Bodenuntersuchungen und Naturschutz.

Das Lloyd Thomas Refektorium war der Hauptspeisesaal der Universität und versorgte Gäste und Catering-Studenten mit Mahlzeiten und einem regelmäßigen Sonntagsbuffet.

Das Media Center enthaltene Studios und Aufnahmeeinrichtungen.

Bischof Burgess Hall früher beherbergte die Abteilungen für Klassik und Philosophie. Im Jahr 2009 wurde es zu einem Zentrum für Studentenservice umgebaut.

Akademische Kleidung[edit]

Eine moderne Reproduktion der originalen Lampeter BA Haube

Ab 1971 verlieh Lampeter einen Abschluss der University of Wales, und als solcher war die akademische Kleidung die der University of Wales – Absolventen trugen ein schwarzes Kleid mit Glockenärmeln für Junggesellen und Handschuhärmeln für Meister. Die Hauben waren mit Mazarinblau-Schussgrün (Kunst), Mazarinblau-Schussrot (Göttlichkeit), Gelbschuss-Schwarz (MSc) und Gelbrotrot, gebundenem Hellblau (MBA) ausgekleidet.

Die akademische Kleidung von Lampeter für die von ihm selbst verliehenen Abschlüsse unterschied sich davon wie folgt:

Studenten trug ein schwarzes Stoffkleid mit Glockenärmeln, wobei der gesamte Ärmel vorne offen war. Das ganzjährige Tragen von akademischer Kleidung für Studenten endete 1971, als Lampeter an die University of Wales wechselte. Zwischen 2006 und 2010 gab es jedoch eine gewisse Unterstützung für eine Wiederbelebung dieser Tradition durch aktuelle Studenten.

Bachelor of Divinity. Ein schwarzes Kleid mit MA-Muster (lange geschlossene Ärmel) mit einem doppelten Halbmondschnitt am Ende jedes Ärmels. Eine schwarze Seidenhaube, mit dunkelvioletter Seide gefüttert und mit 1 „weißer Seide gebunden. Ursprünglich konnte sie entweder in Oxford- oder in Cambridge-Form hergestellt werden, aber Cambridge wurde zur Norm.

Bachelor of Arts. Ein schwarzes Kleid mit Cambridge BA-Muster. Eine schwarze Seidenhaube, teilweise gefüttert und mit ‚Miniver‘ gebunden – weißes Fell mit schwarzen Flecken. (Kaninchen wurde normalerweise mit „Aufkleb“ -Punkten verwendet, wegen der Kosten für echten Miniver!). Wie beim BD konnte es entweder in Oxford- oder in Cambridge-Form hergestellt werden, aber Cambridge wurde zur Norm.

Es gab auch einen zweijährigen Kurs für diejenigen, die sich den dreijährigen nicht leisten konnten. Ab 1884 wurde dies die genannt Lizenz in der Göttlichkeit (LD). Die Inhaber trugen das Studentenkleid mit einer schwarzen Kapuze, die mit schwarzem Stoff gefüttert und mit weißer Seide für 1 Zoll gebunden war. Dies war immer die Form von Cambridge. Die LD wurde nach etwa 1940 nicht mehr vergeben, und 1969 wurde die Kapuze verwendet das DipTh, das verliehen wurde, bis das College 1978 die Ausbildung zum Geistlichen einstellte. 2007 wurde ein Abschluss mit einem ähnlichen Titel eingeführt, das Lizenz in Göttlichkeit (Promotion) (LicDD). Dies ist jedoch ein Postdoktorat in Theologie oder Religionswissenschaft, der erste seiner Art in Großbritannien. Die bis zu diesem Grad vorgeschriebenen Akademiker sind insofern unkonventionell, als sie aus einer scharlachroten Mozzetta bestehen, die mit weißem Fell besetzt ist und über dem Festkleid und unter der Kapuze (des relevanten Wales-Grades) getragen wird und mit einer scharlachroten Haube mit Goldschnur und Quaste. Der Abschluss wurde nur für kurze Zeit vergeben, bevor er fallen gelassen wurde.

Die Universität vergab eine Reihe von Lizenzen in Theologie (LTh), Religionswissenschaft (LRS), Islamwissenschaft, Latein und klassischem Griechisch.

Die Universität verfügt über eine Sporthalle mit Badminton- und Squashplätzen sowie ein Multigym mit Kraftgeräten. Für Outdoor-Sportarten verfügt die Universität über Tennisplätze, ein Cricketfeld und Einrichtungen für Fußball, Hockey und Rugby. Der am 1. Mai 1909 offiziell eröffnete College-Cricket-Pavillon ist heute ein denkmalgeschütztes Gebäude.

Lampeter hat aktive Fecht-, Netball-, Feldhockey-, Fußball- und Rugby-Union-Teams, die alle in den College-Farben Schwarz und Gold spielten.

Rugby[edit]

Rugby wurde Lampeter um 1850 von Vizepräsident Rowland Williams vorgestellt, und als solches kann das College behaupten, die älteste Rugby-Fußballmannschaft in Wales zu haben. Trotz einiger Debatten darüber, ob diese Ehre der Stadtmannschaft oder der Universität gehört, ist die offizielle Geschichte der Welsh Rugby Union „Fields of Praise: Die offizielle Geschichte der Welsh Rugby Union, 1881–1981“.[12] zeigt das College-Team als erstes an. Lampeter Town RFC waren jedoch die Vertreter von Lampeter bei der Gründung der WRU im Jahr 1881.

Der von Wales getragene rote Streifen ist einer der Originalstreifen der Universität, und als solcher ist das College-Team der einzige andere Verein, der ihn tragen darf. Der Verein war eines der Gründungsmitglieder der Welsh Rugby Union im Jahr 1881, wurde jedoch nach Schwierigkeiten bei einem Spiel gegen das University College of Wales in Aberystwyth im Jahr 1933 von der Gewerkschaft gerügt.[13]

Die Spitznamen des Clubs waren Verrückte Pilger und Parsons bekämpfenDies spiegelt Lampeters Geschichte der Ausbildung von Geistlichen wider. Jedes Jahr am ersten Samstag im Dezember fand ein Match zwischen der Studentenmannschaft und einer alten Jungenmannschaft statt. In den letzten Jahren bildeten die alten Jungs eine Touring-Seite, die als Old Parsonians RFC bekannt ist. Die alten Jungen sind bekannt geworden für ihren Schlachtruf „Chuff“, der allgemein verwendet wurde. C. 2001. Alte Parsonianer spielen in einem himmelblauen und weißen Trikot in Anerkennung der historischen Rugby-Verbindung zum Cambridge-Rugby durch Rowland Williams.

Das College schreien[edit]

Aus dem Student Handbook 1938–39 entnommen, wurde das College Yell ursprünglich bei Sport- und anderen Wettkampfveranstaltungen eingesetzt. Es war im 21. Jahrhundert weitgehend in Vergessenheit geraten, obwohl es gelegentlich von eifrigen Studenten wiederbelebt wurde.

Hipp Hipp Hurra
Hipp Hipp Hurra
Hipp Hipp Hurra
Nawr Dewi. Nawr Dewi. Nawr Dewi.
Dy Blant. Dy Blant. Dy Blant.
Backshe Odinthorog. Backshe Odinthorog.
Niri Giri Wari. Niri Giri Wari.
Zey Zey Zey
Bing Bang Odin. Bing Bang Odin.
Io Dewi. Io Dewi. Io Dewi.
Dewi Sant. Dewi Sant. Dewi Sant.

Studentenleben[edit]

Drei Vollzeit-Sabbatical Officers und zehn Non-Sabbatical Officers überwachten die Unterhaltung, das Wohlergehen und die Kinderbetreuung der Studenten und stellten durch die Zugehörigkeit zur National Union of Students sicher, dass die Ansichten der Lampeter-Studenten auf nationaler Ebene vertreten waren. Bis 2015 war dies jedoch auf einen Sabbatical Officer und 16 Nicht-Sabbatical Officers reduziert worden. Die Studentenvereinigung veröffentlichte auch eine beliebte satirische Zeitschrift mit dem Titel 1822, die „Satire, Sinnlosigkeit und Toilettenhumor verbindet“.

Die abgeschiedene ländliche Lage verleiht dem Campus eine besondere Atmosphäre und ein sehr hoher Anteil der Studenten war in Clubs, Gesellschaften und Verbänden engagiert. Es gab über 30 anerkannte Einrichtungen, von der chinesischen Gesellschaft und der Internationalen Studentenvereinigung bis hin zur mittelalterlichen Nachstellung, dem Fechtclub und der Organic Gardening Society. Daneben befanden sich studentische Einrichtungen, die nicht der Studentenvereinigung angeschlossen waren, wie die Christliche Union, die Konservative Zukunft und Amnesty.

Seit die lokale Linie 1965 der Beeching Axe zum Opfer fiel, gab es keine Zugverbindung mehr in die Stadt, und es gibt nur noch begrenzte Busverbindungen. Für viele, die dorthin kamen, war dies jedoch eine Hauptattraktion, da sich ein hoher Anteil der Studenten mit Outdoor-Aktivitäten und lokalen Umweltprojekten beschäftigte. Die lokalen Landstädte Carmarthen und Llandeilo sowie die Küstenorte Aberystwyth und New Quay befinden sich in der Nähe. Das Gewerkschaftsgebäude am Ufer des Afon Dulas und wurde 1998 erweitert und enthält eine Studentenbar und einen kleinen Club, bekannt als Xtension, in dem Partys und Live-Musikveranstaltungen stattfinden. Die Union hat auch einen CineClub, der Filme in der Arts Hall und im Cliff Tucker Theatre zeigt.

Bemerkenswerte Akademiker[edit]

Reverend Professor Rowland Williams

Bemerkenswerte Absolventen[edit]

Akademische Abteilungen[edit]

  • Chinesische Studien[14]
  • Klassiker[15]
  • Film und Medien[16]
  • Englisch[17]
  • Management und Informationstechnologie[18]
  • Philosophie[19]
  • Theologie, Religionswissenschaft und Islamwissenschaft[20]
  • Freiwillige Sektorstudien[21]
  • Archäologie, Geschichte und Anthropologie

Nicht mehr existierende Abteilungen[edit]

Lampeter Geography School[edit]

Das Lampeter Geography School war eine wichtige Sammlung von Akademikern am Geographie-Institut der University of Wales in Lampeter. Die Abteilung hat inzwischen geschlossen, aber die Lampeter-Diaspora hat weiterhin einen großen Einfluss auf die akademische Disziplin.

Einrichtung[edit]

Der Robbins-Bericht von 1963 empfahl die sofortige Erweiterung der britischen Universitäten. Bei der Umsetzung dieser Empfehlungen plante Lampeter die Eröffnung neuer Abteilungen für Wirtschaft und Geographie. Wirtschaftswissenschaften wurden nur im ersten Jahr unterrichtet. Die Grundlagen für die Eröffnung der Abteilung Geographie waren 1970 oder 1971 gut gelegt. Das neue Kunstgebäude der Universität wurde am 4. Oktober 1971 vom walisischen Außenminister eröffnet, wodurch die neue Abteilung luxuriöse Vortrags- und Unterrichtsräume erhielt Zeit für seine Eröffnung. Dr. David Thomas (nicht zu verwechseln mit David SG Thomas, Professor in Oxford) wurde 1970 der erste Professor für Geographie in Lampeter, und 1971 kamen Donald A. Davidson und John A. Dawson als Dozenten zu den Mitarbeitern, um den ersten zu begrüßen Geographiestudenten nach Lampeter im Oktober 1971.

Akademiker der Lampeter Geography School[edit]

Siehe auch[edit]

Verweise[edit]

  1. ^ „Schals der University of Wales“. Abgerufen 21. August 2007.
  2. ^ Offizielle Website der Universität (abgerufen am 28. Dezember 2014)
  3. ^ „Fusion des BBC News College durch königliche Charta besiegelt“. BBC News. 22. Juli 2010. Abgerufen 22. Juli 2010.
  4. ^ „Editorial [untitled]““. Waliser. 24. Februar 1865. S. 4–5. Abgerufen 13. Dezember 2018.
  5. ^ „Institutionelle Überprüfung – Universität von Wales, Lampeter“. Qaa.ac.uk. 25. Mai 2007. Archiviert von das Original am 25. März 2010. Abgerufen 2. Mai 2010.
  6. ^ „Pressemitteilung: Eine neue Universität in Wales?“. Lamp.ac.uk. 11. Dezember 2008. Archiviert von das Original am 11. Juni 2011. Abgerufen 2. Mai 2010.
  7. ^ Hodges, Lucy (19. Februar 2009). „Ist eine Fusion der einzige Weg, um Lampeter zu retten? – Hochschulbildung“. Der Unabhängige. London. Abgerufen 2. Mai 2010.
  8. ^ „Trinity College Carmarthen – Gespräche über neue Universität beginnen“. Times Higher Education. 1. Januar 2009. Abgerufen 2. Mai 2010.
  9. ^ „University of Wales Trinity Saint David – Fehler 404: Seite nicht gefunden“. Trinitysaintdavid.ac.uk. Abgerufen 18. November 2014. [permanent dead link]
  10. ^ „University of Wales Trinity Saint David – Fehler 404: Seite nicht gefunden“. Trinitysaintdavid.ac.uk. Abgerufen 18. November 2014. [permanent dead link]
  11. ^ „St.david’s University College (Originalgebäude) College Street, Lampeter Auflistungsdatum: 21. September 1964 Cadw Building ID: 10431“. Britisch denkmalgeschützte Gebäude. Abgerufen 4. Januar 2016.
  12. ^ Felder des Lobes, Die offizielle Geschichte der Welsh Rugby Union 1881–1981 S. 259, David Smith, Gareth Williams (1980)
  13. ^ Price, DTW (David Trevor William) (1977–1990). Eine Geschichte des Saint David’s University College Lampeter. Cardiff: University of Wales Press. ISBN 0-7083-0606-3. OCLC 3742391.
  14. ^ „Universität von Wales, Lampeter – Zentrum für Chinesische Studien“. Lamp.ac.uk. 13. Februar 2010. Archiviert von das Original am 26. Juli 2010. Abgerufen 2. Mai 2010.
  15. ^ „University of Wales Lampeter – Abteilung für Klassiker“. Lamp.ac.uk. Archiviert von das Original am 24. März 2010. Abgerufen 2. Mai 2010.
  16. ^ „Film und Medien an der Universität von Wales, Lampeter, UK“. Lamp.ac.uk. Archiviert von das Original am 2. April 2010. Abgerufen 2. Mai 2010.
  17. ^ „University of Wales Lampeter – Institut für Englisch“. Lamp.ac.uk. Archiviert von das Original am 1. Juli 2010. Abgerufen 2. Mai 2010.
  18. ^ „Management & Informationstechnologie – University of Wales Lampeter“. Lamp.ac.uk. Archiviert von das Original am 29. April 2010. Abgerufen 2. Mai 2010.
  19. ^ „University of Wales Lampeter | Institut für Philosophie“. Lamp.ac.uk. 1. September 2009. Archiviert von das Original am 7. Mai 2010. Abgerufen 2. Mai 2010.
  20. ^ „Institut für Theologie und Religionswissenschaft, University of Wales Lampeter“. Lamp.ac.uk. Archiviert von das Original am 15. Mai 2010. Abgerufen 2. Mai 2010.
  21. ^ „Voluntary Sector Studies – Fernunterricht für den Voluntary Sector“. Volstudy.ac.uk. Archiviert von das Original am 11. Juni 2010. Abgerufen 2. Mai 2010.

Literaturverzeichnis[edit]

  • DTW Preis, Eine Geschichte des Saint David’s University College in Lampeter;; Band Eins bis 1898. Cardiff: University of Wales Press (ISBN 0-7083-0606-3).
  • –do .– Band Zwei 1898–1971 Cardiff: University of Wales Press (ISBN 0-7083-1062-1).
  • DTW Preis, Jahr Esgob Burgess a Choleg Llanbedr: Bischof Burgess und Lampeter College. Cardiff: University of Wales Press (ISBN 0-7083-0965-8).
  • Nicholas Groves Akademische Roben des Saint David’s College Lampeter (1822–1971), (Universität von Wales, Lampeter Special Publications) (ISBN 0-905285-68-9).

Externe Links[edit]

Koordinaten: 52 ° 06’50 “ N. 4 ° 04’33 “ W./.52,1139 ° N 4,0759 ° W./. 52,1139; -4.0759


Luftkompressor – Wikipedia

Maschine zum Druckbeaufschlagen von Luft

Luftkompressor liefert Luft in eine Nagelpistole

Ein Luftkompressor ist ein pneumatisches Gerät, das Leistung (unter Verwendung eines Elektromotors, Diesel- oder Benzinmotors usw.) in potentielle Energie umwandelt, die in Druckluft (dh Druckluft) gespeichert ist. Durch eine von mehreren Methoden drückt ein Luftkompressor immer mehr Luft in einen Speichertank, wodurch der Druck erhöht wird. Wenn der Tankdruck seine technische Obergrenze erreicht, schaltet der Luftkompressor ab. Die Druckluft wird dann bis zur Inbetriebnahme im Tank gehalten.[1] Die in der Druckluft enthaltene Energie kann für eine Vielzahl von Anwendungen verwendet werden, wobei die kinetische Energie der Luft genutzt wird, wenn sie freigesetzt wird und der Tank drucklos wird. Wenn der Tankdruck seine Untergrenze erreicht, schaltet sich der Luftkompressor wieder ein und setzt den Tank wieder unter Druck. Ein Luftkompressor muss von einer Pumpe unterschieden werden, da er für jedes Gas / jede Luft funktioniert, während Pumpen mit einer Flüssigkeit arbeiten.

Einstufung[edit]

Kompressoren können nach dem abgegebenen Druck klassifiziert werden:

  1. Niederdruckluftkompressoren (LPACs) mit einem Auslassdruck von 10 bar pro Quadratzoll oder weniger[2]
  2. Mitteldruckkompressoren mit einem Auslassdruck von 10,4 bis 68,9 bar (151 bis 1.000 Pfund pro Quadratzoll)[2]
  3. Hochdruckluftkompressoren (HPACs) mit einem Auslassdruck von über 69 bar (1.000 Pfund pro Quadratzoll)[2]

Sie können auch nach Design und Funktionsprinzip klassifiziert werden:

  1. Einstufiger Kolbenkompressor
  2. Zweistufiger Kolbenkompressor
  3. Verbundkompressor[clarification needed]
  4. Schraubenkompressor
  5. Drehschieberpumpe
  6. Scroll-Kompressor
  7. Turbokompressor
  8. Radialkompressor

Verdrängungsart[edit]

Es gibt zahlreiche Methoden der Luftkompression, die entweder in Verdrängungs- oder roto-dynamische Typen unterteilt sind.[3]

Verdrängung[edit]

Verdrängerkompressoren arbeiten, indem sie Luft in eine Kammer drücken, deren Volumen verringert wird, um die Luft zu komprimieren. Sobald der maximale Druck erreicht ist, öffnet sich ein Anschluss oder Ventil und Luft wird aus der Kompressionskammer in das Auslasssystem abgelassen.[4] Übliche Arten von Verdrängerkompressoren sind

  • Kolbentyp: Luftkompressoren verwenden dieses Prinzip, indem sie durch konstante Bewegung der Kolben Luft in eine Luftkammer pumpen. Sie verwenden Einwegventile, um Luft in eine Kammer hinein und aus dieser heraus zu leiten, deren Basis aus einem beweglichen Kolben besteht. Wenn sich der Kolben im Abwärtshub befindet, saugt er Luft in die Kammer. Wenn es an ist

    Technische Darstellung eines zweistufigen Luftkompressors

    Bei seinem Aufwärtshub wird die Luftladung in einen Lagertank gedrückt. Kolbenkompressoren fallen im Allgemeinen in zwei Grundkategorien, einstufig und zweistufig. Einstufige Kompressoren fallen normalerweise in den Bereich von 5 bis 5 PS. Zweistufige Kompressoren fallen normalerweise

    Technische Darstellung eines tragbaren einstufigen Luftkompressors

    in den Bereich von 5 bis 30 PS. Zweistufige Kompressoren bieten einen höheren Wirkungsgrad als ihre einstufigen Gegenstücke. Aus diesem Grund sind diese Kompressoren die häufigsten Einheiten in der Kleinunternehmensgemeinschaft. Die Kapazitäten für einstufige und zweistufige Kompressoren werden im Allgemeinen in PS (PS), Standardkubikfuß pro Minute (SCFM) * und Pfund pro Quadratzoll (PSI) angegeben. * In geringerem Maße werden einige Kompressoren in tatsächlichen Kubikfuß pro Minute (ACFM) angegeben. Wieder andere werden in Kubikfuß pro Minute (CFM) angegeben. Die Verwendung von CFM zur Bewertung eines Kompressors ist falsch, da es eine Durchflussrate darstellt, die unabhängig von einer Druckreferenz ist. dh 20 CFM bei 60 PSI.

  • Rotationsschraubenkompressoren: Verwenden Sie eine Verdrängungskompression, indem Sie zwei Spiralschrauben zusammenbringen, die beim Drehen die Luft in eine Kammer leiten, deren Volumen sich beim Drehen der Schrauben verringert.
  • Flügelzellenkompressoren: Verwenden Sie einen geschlitzten Rotor mit unterschiedlicher Blattplatzierung, um Luft in eine Kammer zu leiten und das Volumen zu komprimieren. Dieser Kompressortyp liefert ein festes Luftvolumen bei hohen Drücken.

Dynamische Verschiebung[edit]

Dynamische Verdrängungsluftkompressoren umfassen Radialkompressoren und Axialkompressoren. Bei diesen Typen überträgt eine rotierende Komponente ihre kinetische Energie an die Luft, die schließlich in Druckenergie umgewandelt wird. Diese verwenden die von einem sich drehenden Laufrad erzeugte Zentrifugalkraft, um die aufgenommene Luft zu beschleunigen und dann abzubremsen, wodurch sie unter Druck gesetzt wird.

Kühlung[edit]

Aufgrund der adiabatischen Erwärmung erfordern Luftkompressoren eine Methode zur Abgabe von Abwärme. Im Allgemeinen ist dies eine Form der Luft- oder Wasserkühlung, obwohl einige (insbesondere rotierende) Kompressoren durch Öl gekühlt werden können (das heißt wiederum luft- oder wassergekühlt).[5] Die atmosphärischen Veränderungen werden auch beim Abkühlen von Kompressoren berücksichtigt. Die Art der Kühlung wird unter Berücksichtigung der Faktoren wie Einlasstemperatur, Umgebungstemperatur, Leistung des Kompressors und Anwendungsbereich bestimmt. Es gibt keinen einzigen Kompressortyp, der für eine Anwendung verwendet werden könnte.

Anwendungen[edit]

Tragbarer Luftkompressor zum Antreiben von Werkzeugen wie Presslufthämmern

Luftkompressoren haben viele Verwendungszwecke, einschließlich: Zuführen von sauberer Hochdruckluft zum Befüllen von Gasflaschen, Zuführen von sauberer Luft mit mittlerem Druck zu einem Taucher mit untergetauchter Oberfläche, Zuführen von sauberer Luft mit mittlerem Druck zum Antreiben einiger pneumatischer HLK-Steuersystemventile für Büro- und Schulgebäude Zuführen einer großen Menge Luft mit mittlerem Druck zum Antrieb von Druckluftwerkzeugen wie Presslufthämmern, Befüllen von Hochdrucklufttanks (HPA), zum Befüllen von Reifen und zum Erzeugen großer Mengen von Luft mit mittlerem Druck für industrielle Großprozesse (z als Oxidation für Erdölkoks- oder Zementpflanzensack-Hausspülsysteme).[6]

Die meisten Luftkompressoren sind entweder Kolbenkolben, Drehschaufeln oder Drehschrauben. Radialkompressoren sind in sehr großen Anwendungen üblich, während Drehschraube, Spirale,[7] und Kolbenluftkompressoren werden für kleinere, tragbare Anwendungen bevorzugt.

Es gibt zwei Haupttypen von Luftkompressorpumpen: Öleinspritzpumpen und ölfreie. Das ölfreie System hat eine technischere Entwicklung, ist jedoch teurer, lauter und hält weniger lange als ölgeschmierte Pumpen. Das ölfreie System liefert auch Luft von besserer Qualität.

Luftkompressoren sind für die Verwendung einer Vielzahl von Stromquellen ausgelegt. Während gas- / dieselbetriebene und elektrische Luftkompressoren zu den beliebtesten gehören, werden Luftkompressoren, die Fahrzeugmotoren, Nebenabtriebs- oder Hydraulikanschlüsse verwenden, auch häufig in mobilen Anwendungen verwendet.[8]

Die Leistung eines Kompressors wird in PS (PS) und CFM (Kubikfuß pro Minute Ansaugluft) gemessen.[9]

Die Gallonengröße des Tanks gibt das verfügbare Druckluftvolumen (in Reserve) an. Gas- / Diesel-Kompressoren werden häufig in abgelegenen Gebieten mit problematischem Zugang zu Elektrizität eingesetzt. Sie sind laut und benötigen eine Belüftung für Abgase. Elektrisch angetriebene Kompressoren werden häufig in Produktionsstätten, Werkstätten und Werkstätten mit ständigem Zugang zu Elektrizität eingesetzt. Übliche Werkstatt- / Garagenkompressoren sind 110-120 Volt oder 230-240 Volt. Kompressortankformen sind: „Pfannkuchen“, „Zwillingstank“, „horizontal“ und „vertikal“. Je nach Größe und Zweck können Kompressoren stationär oder tragbar sein.

Instandhaltung[edit]

Ein kleiner Luftkompressor, der in einer Reifenreparaturwerkstatt am Straßenrand im Dorf Kodo, Niger, verwendet wird.

Um sicherzustellen, dass alle Kompressortypen effizient und ohne Undichtigkeiten arbeiten, müssen routinemäßige Wartungsarbeiten durchgeführt werden, z. B. die Überwachung und der Austausch von Luftkompressorarmaturen. Die meisten Luftkompressoren können gemäß den Anweisungen im beiliegenden Handbuch betrieben werden.[10] Es wird empfohlen, dass Besitzer von Luftkompressoren tägliche Inspektionen ihrer Geräte durchführen, z.

  • Auf Öl- und Luftlecks prüfen
  • Differenzdruck im Druckluftfilter prüfen
  • Festlegen, ob das Öl im Kompressor gewechselt werden soll oder nicht
  • Überprüfung der sicheren Betriebstemperatur
  • Kondenswasser aus den Luftbehältern ablassen

Siehe auch[edit]

Verweise[edit]


SNARE (Protein) – Wikipedia

Molekulare Maschinerie, die die Vesikelfusion bei der Freisetzung von Neuromediatoren antreibt. Der Kern-SNARE-Komplex besteht aus vier α-Helices, die von Synaptobrevin, Syntaxin und SNAP-25 beigesteuert werden. Synaptotagmin dient als Kalziumsensor und reguliert das SNARE-Zipping genau.[1]

SNARE-Proteine – „SNAP. REceptor „- sind eine große Proteinfamilie, die aus mindestens 24 Mitgliedern in Hefen und mehr als 60 Mitgliedern in Säugetierzellen besteht.[2][3] Die Hauptaufgabe von SNARE-Proteinen besteht darin, die Vesikelfusion zu vermitteln – die Fusion von Vesikeln mit der Zielmembran; Dies vermittelt insbesondere die Exozytose, kann aber auch die Fusion von Vesikeln mit membrangebundenen Kompartimenten (wie einem Lysosom) vermitteln. Die am besten untersuchten SNAREs sind diejenigen, die die Neurotransmitterfreisetzung von synaptischen Vesikeln in Neuronen vermitteln. Diese neuronalen SNAREs sind die Ziele der Neurotoxine, die für Botulismus und Tetanus verantwortlich sind, die von bestimmten Bakterien produziert werden.

SNAREs können in zwei Kategorien unterteilt werden: Vesikel oder v-SNAREs, die während des Knospens in die Membranen von Transportvesikeln eingebaut werden, und Ziel oder t-SNAREs, die mit Nervenendmembranen assoziiert sind. Es gibt Hinweise darauf, dass t-SNAREs stabile Subkomplexe bilden, die als Leitfaden für v-SNARE dienen und in die Membran eines proteinbeschichteten Vesikels eingebaut sind, um die Bildung des SNARE-Komplexes zu vervollständigen.[4] Mehrere SNARE-Proteine ​​befinden sich sowohl auf Vesikeln als auch auf Zielmembranen. Daher berücksichtigt ein neueres Klassifizierungsschema strukturelle Merkmale von SNAREs und unterteilt sie in R-SNAREs und Q-SNAREs. Oft fungieren R-SNAREs als v-SNAREs und Q-SNAREs als t-SNAREs. R-SNAREs sind Proteine, die einen Arginin (R) -Rest zur Bildung der Nullionenschicht im zusammengesetzten Kern-SNARE-Komplex beitragen. Eine besondere R-SNARE ist Synaptobrevin, das sich in den synaptischen Vesikeln befindet. Q-SNAREs sind Proteine, die einen Glutamin (Q) -Rest zur Bildung der Nullionenschicht im zusammengesetzten Kern-SNARE-Komplex beitragen. Q-SNAREs umfassen Syntaxin und SNAP-25. Q-SNAREs werden abhängig von ihrer Position im Vier-Helix-Bündel weiter als Qa, Qb oder Qc klassifiziert.

Struktur[edit]

SNAREs sind kleine, häufig vorkommende, manchmal schwanzverankerte Proteine, die häufig posttranslational über eine C-terminale Transmembrandomäne in Membranen inseriert werden. Sieben der 38 bekannten SNAREs, einschließlich SNAP-25, haben keine Transmembrandomäne und sind stattdessen über Lipidmodifikationen wie Palmitoylierung an die Membran gebunden.[5] Schwanzverankerte Proteine ​​können unter anderem in die Plasmamembran, das endoplasmatische Retikulum, die Mitochondrien und die Peroxisomen eingefügt werden, obwohl jede bestimmte SNARE auf eine einzigartige Membran abzielt. Das Targeting von SNAREs wird erreicht, indem entweder die Zusammensetzung der C-terminalen flankierenden Aminosäurereste oder die Länge der Transmembrandomäne verändert wird. Das Ersetzen der Transmembrandomäne durch Lipidanker führt zu einem Zwischenstadium der Membranfusion, in dem nur die beiden sich berührenden Blättchen verschmelzen und nicht die beiden distalen Blättchen der beiden Membrandoppelschichten.[6]

Obwohl sich SNAREs in Struktur und Größe erheblich unterscheiden, teilen sie alle ein Segment in ihrer cytosolischen Domäne, das als SNARE-Motiv bezeichnet wird und aus 60-70 Aminosäuren besteht und Heptad-Wiederholungen enthält, die die Fähigkeit haben, Coiled-Coil-Strukturen zu bilden. V- und t-SNAREs können reversibel zu engen Vier-Helix-Bündeln zusammengesetzt werden, die als „trans“ -SNARE-Komplexe bezeichnet werden. In synaptischen Vesikeln bestehen die leicht gebildeten metastabilen „trans“ -Komplexe aus drei SNAREs: Syntaxin 1 und SNAP-25, die in der Zellmembran vorhanden sind, und Synaptobrevin (auch als Vesikel-assoziiertes Membranprotein oder VAMP bezeichnet), das in der Vesikelmembran verankert ist.

Bei der neuronalen Exozytose sind Syntaxin und Synaptobrevin durch ihre C-terminalen Domänen in den jeweiligen Membranen verankert, während SNAP-25 über mehrere Cystein-verknüpfte Palmitoylketten an die Plasmamembran gebunden ist. Der Kern trans-SNARE-Komplex ist ein Vier-

α{ displaystyle alpha}

-helix Bündel, wo man

α{ displaystyle alpha}

-helix wird von Syntaxin 1, eins beigesteuert

α{ displaystyle alpha}

-Helix von Synaptobrevin und zwei

α{ displaystyle alpha}

-Helices werden von SNAP-25 beigesteuert.

Es wurde gezeigt, dass die in der Plasmamembran residenten SNAREs in verschiedenen Mikrodomänen oder Clustern vorhanden sind, deren Integrität für die exozytotische Kompetenz der Zelle wesentlich ist.

Membranfusion[edit]

Schichtung des Kern-SNARE-Komplexes. In der Mitte befindet sich die null hydrophile Ionenschicht, flankiert von hydrophoben Leucin-Zipper-Schichten.

Während der Membranfusion bilden v-SNARE- und t-SNARE-Proteine ​​auf getrennten Membranen zusammen einen trans-SNARE-Komplex, der auch als „SNAREpin“ bekannt ist. Abhängig vom Stadium der Fusion der Membranen können diese Komplexe unterschiedlich bezeichnet werden.

Während der Fusion von trans-SNARE-Komplexe, die Membranen verschmelzen und SNARE-Proteine, die an der Komplexbildung nach der Fusion beteiligt sind, werden dann als „cis„-SNARE-Komplex, weil sie jetzt in einem einzigen (oder cis) resultierende Membran. Nach der Fusion wird die cis-SNARE-Komplex wird durch ein Adapterprotein, Alpha-SNAP, gebunden und zerlegt. Dann katalysiert die als NSF bezeichnete hexamere ATPase (vom AAA-Typ) die ATP-abhängige Entfaltung der SNARE-Proteine ​​und setzt sie zum Recycling in das Cytosol frei.

Es wird angenommen, dass SNAREs die wichtigsten erforderlichen Komponenten der Fusionsmaschinerie sind und unabhängig von zusätzlichen zytosolischen akzessorischen Proteinen funktionieren können. Dies wurde durch Engineering von „gespiegelten“ SNAREs demonstriert, bei denen die SNARE-Domänen eher dem extrazellulären Raum als dem Cytosol zugewandt sind. Wenn Zellen, die v-SNAREs enthalten, Zellen kontaktieren, die t-SNAREs enthalten, trans-SNARE-Komplexe bilden sich und es kommt zur Zell-Zell-Fusion.[7]

Komponenten[edit]

Der Kern-SNARE-Komplex ist ein 4-

α{ displaystyle alpha}

-helix-Bundle.[8] Synaptobrevin und Syntaxin tragen dazu bei

α{ displaystyle alpha}

-helix jeweils, während SNAP-25 mit zwei teilnimmt

α{ displaystyle alpha}

-helices (abgekürzt als Sn1 und Sn2). Die wechselwirkenden Aminosäurereste, die den SNARE-Komplex zippen, können in Schichten gruppiert werden. Jede Schicht hat 4 Aminosäurereste – jeweils einen Rest pro 4

α{ displaystyle alpha}

-helices. Im Zentrum des Komplexes befindet sich das keine Ionenschicht Es besteht aus einem Arginin (R) – und drei Glutamin (Q) -Resten und wird von Leucin-Reißverschlüssen flankiert. Die Schichten ‚-1‘, ‚+1‘ und ‚+2‘ in der Mitte des Komplexes folgen am ehesten der idealen Leucin-Reißverschluss-Geometrie und Aminosäure-Zusammensetzung.[9]

Das keine Ionenschicht besteht aus R56 aus VAMP-2, Q226 aus Syntaxin-1A, Q53 aus Sn1 und Q174 aus Sn2 und ist vollständig in den Leucin-Zipper-Schichten vergraben. Die positiv geladene Guanidinogruppe des Arginin (R) -Rests interagiert mit den Carboxylgruppen jedes der drei Glutamin (Q) -Reste.

Die flankierenden Leucin-Reißverschluss-Schichten wirken als wasserdichte Abdichtung, um die ionischen Wechselwirkungen vor dem umgebenden Lösungsmittel abzuschirmen. Belichtung der keine Ionenschicht Das Brechen des flankierenden Leucin-Reißverschlusses zum Wasserlösungsmittel führt zur Instabilität des SNARE-Komplexes und ist der mutmaßliche Mechanismus, durch den

α{ displaystyle alpha}

-SNAP und NSF recyceln die SNARE-Komplexe nach Abschluss der Exozytose der synaptischen Vesikel.

Mechanismus der Membranfusion[edit]

Versammlung[edit]

Darstellung der Bildung von a trans-SNARE-Komplex. Zeigt, wie Munc18 während der Komplexbildung mit den SNARE-Proteinen interagiert.

SNARE-Proteine ​​müssen sich zusammensetzen trans-SNARE-Komplexe, um die Kraft bereitzustellen, die für die Vesikelfusion erforderlich ist. Die vier α-Helix-Domänen (jeweils eine aus Synaptobrevin und Syntaxin und zwei aus SNAP-25) bilden zusammen ein Coiled-Coil-Motiv. Der geschwindigkeitsbestimmende Schritt im Assemblierungsprozess ist die Assoziation der Syntaxin-SNARE-Domäne, da sie normalerweise in einem „geschlossenen“ Zustand gefunden wird, in dem sie nicht mit anderen SNARE-Proteinen interagieren kann.[10] Wenn Syntaxin offen ist, transDie Bildung des SNARE-Komplexes beginnt mit der Assoziation der vier SNARE-Domänen an ihren N-Termini. Die SNARE-Domänen bilden ein Coiled-Coil-Motiv in Richtung der C-Termini ihrer jeweiligen Domänen.

Es wird angenommen, dass das SM-Protein Munc18 eine Rolle beim Aufbau des SNARE-Komplexes spielt, obwohl der genaue Mechanismus, nach dem es wirkt, noch diskutiert wird. Es ist bekannt, dass der Verschluss von Munc18 Syntaxin in einer geschlossenen Konformation sperrt, indem er an seine α-helikalen SNARE-Domänen bindet, wodurch Syntaxin daran gehindert wird, in SNARE-Komplexe einzudringen (wodurch die Fusion gehemmt wird).[10] Der Verschluss ist jedoch auch in der Lage, das gesamte Vier-Helix-Bündel des zu binden trans-SNARE-Komplex. Eine Hypothese legt nahe, dass der Munc18-Verschluss während des Zusammenbaus des SNARE-Komplexes geschlossenes Syntaxin freisetzt, mit dem N-terminalen Peptid des Syntaxins assoziiert bleibt (was die Assoziation der Syntaxin-SNARE-Domäne mit anderen SNARE-Proteinen ermöglicht) und sich dann wieder an die neu gebildeten vier anschließt -helix SNARE-Komplex.[11] Dieser mögliche Mechanismus der Dissoziation und der anschließenden erneuten Assoziation mit den SNARE-Domänen könnte calciumabhängig sein.[12] Dies unterstützt die Idee, dass Munc18 eine wichtige regulatorische Rolle bei der Vesikelfusion spielt; Unter normalen Bedingungen wird die Bildung des SNARE-Komplexes durch Munc18 verhindert. Wenn der Munc18 jedoch ausgelöst wird, hilft er tatsächlich beim Aufbau des SNARE-Komplexes und wirkt dadurch als Fusionskatalysator.[11]

Reißverschluss und Fusionsporenöffnung[edit]

Diese Abbildung bietet einen einfachen Überblick über die Wechselwirkung von SNARE-Proteinen mit Vesikeln während der Exozytose. Zeigt die komplexe Montage, Reißverschluss und Demontage von SNARE an.

Die Membranfusion ist eine energetisch anspruchsvolle Reihe von Ereignissen, die die Translokation von Proteinen in der Membran und die Zerstörung der Lipiddoppelschicht sowie die Reformation einer stark gekrümmten Membranstruktur erfordert. Der Prozess des Zusammenbringens zweier Membranen erfordert Eingangsenergie, um die abstoßenden elektrostatischen Kräfte zwischen den Membranen zu überwinden. Der Mechanismus, der die Bewegung membranassoziierter Proteine ​​von der Membrankontaktzone vor der Fusion weg reguliert, ist unbekannt, aber es wird angenommen, dass die lokale Zunahme der Membrankrümmung zu diesem Prozess beiträgt. SNAREs erzeugen Energie durch Protein-Lipid- und Protein-Protein-Wechselwirkungen, die als treibende Kraft für die Membranfusion wirken.

Ein Modell vermutet, dass die Kraft, die erforderlich ist, um zwei Membranen während der Fusion zusammenzubringen, von der Konformationsänderung in herrührt trans-SNARE-Komplexe bilden cis-SNARE-Komplexe. Die aktuelle Hypothese, die diesen Prozess beschreibt, wird als SNARE „Zippering“ bezeichnet.[13]

Wenn der trans-SNARE-Komplex wird gebildet, die SNARE-Proteine ​​befinden sich immer noch auf gegenüberliegenden Membranen. Wenn sich die SNARE-Domänen spontan weiter wickeln, bilden sie ein viel engeres und stabileres Vier-Helix-Bündel. Während dieses „Reißverschlusses“ des SNARE-Komplexes wird angenommen, dass ein Teil der durch die Bindung freigesetzten Energie als molekulare Biegespannung in den einzelnen SNARE-Motiven gespeichert wird. Es wird postuliert, dass diese mechanische Spannung in den halbstarren Linkerregionen zwischen den Transmembrandomänen und dem SNARE-Helixbündel gespeichert wird.[14][15] Die energetisch ungünstige Biegung wird minimiert, wenn sich der Komplex peripher zum Ort der Membranfusion bewegt. Infolgedessen überwindet der Abbau der Spannung die Abstoßungskräfte zwischen dem Vesikel und der Zellmembran und drückt die beiden Membranen zusammen.[16]

Es wurden mehrere Modelle vorgeschlagen, um den nachfolgenden Schritt – die Bildung von Stiel und Fusionsporen – zu erklären. Die genaue Art dieser Prozesse bleibt jedoch umstritten. In Übereinstimmung mit der „Zipper“ -Hypothese übt das sich verschärfende Helixbündel bei der Bildung des SNARE-Komplexes eine Torsionskraft auf die Domänen der Transmembrandomänen (TM) von Synaptobrevin und Syntaxin aus.[17] Dies bewirkt, dass die TM-Domänen innerhalb der getrennten Membranen kippen, wenn sich die Proteine ​​enger wickeln. Die instabile Konfiguration der TM-Domänen führt schließlich dazu, dass die beiden Membranen fusionieren und die SNARE-Proteine ​​innerhalb derselben Membran zusammenkommen, was als „cis„-SNARE-Komplex.[18] Infolge der Lipidumlagerung öffnet sich eine Fusionspore und lässt den chemischen Inhalt des Vesikels in die äußere Umgebung gelangen.

Die Kontinuumserklärung der Stielbildung legt nahe, dass die Membranfusion mit einem infinitesimalen Radius beginnt, bis sie sich radial zu einer stielartigen Struktur ausdehnt. Eine solche Beschreibung berücksichtigt jedoch nicht die Molekulardynamik von Membranlipiden. Neuere molekulare Simulationen zeigen, dass die Lipide durch die Nähe der Membranen gespreizt werden können, wobei eine Population von Lipiden ihre hydrophoben Schwänze in die benachbarte Membran einführt – wodurch effektiv ein „Fuß“ in jeder Membran bleibt. Die Auflösung des gespreizten Lipidzustands erfolgt spontan unter Bildung der Stielstruktur. In dieser molekularen Ansicht ist der Zwischenzustand des gespreizten Lipids eher die geschwindigkeitsbestimmende Barriere als die Bildung des Stiels, der nun zum Minimum der freien Energie wird. Die energetische Barriere zur Herstellung der Konformation des gespreizten Lipids ist direkt proportional zum Abstand zwischen den Membranen. Die SNARE-Komplexe und ihr Zusammenpressen der beiden Membranen könnten daher die freie Energie liefern, die zur Überwindung der Barriere erforderlich ist.[19]

Demontage[edit]

Der Energieeinsatz, der für die SNARE-vermittelte Fusion erforderlich ist, stammt aus der Demontage des SNARE-Komplexes. Die vermutete Energiequelle ist der N-Ethylmaleimid-sensitive Faktor (NSF), eine ATPase, die an der Membranfusion beteiligt ist. NSF-Homohexamere binden und dissoziieren zusammen mit dem NSF-Cofaktor α-SNAP den SNARE-Komplex, indem sie den Prozess mit der ATP-Hydrolyse koppeln.[20] Dieser Prozess ermöglicht die Wiederaufnahme von Synaptobrevin zur weiteren Verwendung in Vesikeln, während die anderen SNARE-Proteine ​​mit der Zellmembran assoziiert bleiben.

Die dissoziierten SNARE-Proteine ​​haben einen höheren Energiezustand als die stabileren cis-SNARE-Komplex. Es wird angenommen, dass die Energie, die die Fusion antreibt, aus dem Übergang zu einer niedrigeren Energie stammt cis-SNARE-Komplex. Die ATP-Hydrolyse-gekoppelte Dissoziation von SNARE-Komplexen ist eine Energieinvestition, die mit dem „Spannen der Pistole“ verglichen werden kann, so dass der Prozess nach Auslösung der Vesikelfusion spontan und mit optimaler Geschwindigkeit stattfindet. Ein vergleichbarer Prozess findet in Muskeln statt, in denen die Myosinköpfe zuerst ATP hydrolysieren müssen, um die notwendige Konformation für die Interaktion mit Aktin und den anschließenden Kraftschlag anzupassen.

Regulatorische Effekte auf die Exozytose[edit]

Regulation über SNAP-25-Palmitoylierung[edit]

Das Q-SNARE-Protein Synaptosomal-assoziiertes Protein 25 (SNAP-25) besteht aus zwei α-helikalen Domänen, die durch einen zufälligen Spulenlinker verbunden sind. Die zufällige Spulenlinkerregion ist am bemerkenswertesten für ihre vier Cysteinreste.[21] Die α-helikalen Domänen bilden zusammen mit denen von Syntaxin und Synaptobrevin (auch als Vesikel-assoziiertes Membranprotein oder VAMP bekannt) den 4-α-Helix-Coiled-Coil-SNARE-Komplex, der für eine effiziente Exozytose entscheidend ist.

Während Syntaxin und Synaptobrevin beide Transmembrandomänen enthalten, die das Andocken an Ziel- bzw. Vesikelmembranen ermöglichen, beruht SNAP-25 auf der Palmitoylierung von Cysteinresten, die in seiner zufälligen Spulenregion gefunden wurden, um an die Zielmembran anzudocken. Einige Studien haben gezeigt, dass die Assoziation mit Syntaxin über SNARE-Wechselwirkungen die Notwendigkeit solcher Docking-Mechanismen ausschließt. Syntaxin-Knockdown-Studien zeigten jedoch keine Abnahme des membrangebundenen SNAP-25, was darauf hindeutet, dass alternative Docking-Mittel existieren.[22] Die kovalente Bindung von Fettsäureketten an SNAP-25 über Thioesterbindungen mit einem oder mehreren Cysteinresten sorgt daher für eine Regulation des Andockens und letztendlich der SNARE-vermittelten Exozytose. Dieser Prozess wird durch ein spezialisiertes Enzym namens DHHC-Palmitoyltransferase vermittelt.[23] Es wurde auch gezeigt, dass die cysteinreiche Domäne von SNAP-25 schwach mit der Plasmamembran assoziiert ist, wodurch sie möglicherweise in der Nähe des Enzyms für die anschließende Palmitoylierung lokalisiert werden kann. Die Umkehrung dieses Prozesses wird von einem anderen Enzym namens Palmitoylprotein-Thioesterase durchgeführt (siehe Abbildung).

Eine vereinfachte Darstellung der Palmitoylierung eines Cysteinrests in einem Protein

Es wird auch angenommen, dass die Verfügbarkeit von SNAP-25 im SNARE-Komplex möglicherweise räumlich durch Lokalisierung von Lipidmikrodomänen in der Zielmembran reguliert wird. Palmitoylierte Cysteinreste konnten über eine günstige Lipidumgebung (möglicherweise cholesterinreich), die zu den an die Cysteinreste von SNAP-25 gebundenen Fettsäureketten komplementär ist, in der gewünschten Zielmembranregion lokalisiert werden.[24]

SNAP-25-Regulation spannungsgesteuerter Ca2 + -Kanäle in neuronalen Axonterminals[edit]

Wenn ein Aktionspotential das Axonterminal erreicht, stimulieren Depolarisationsereignisse die Öffnung spannungsgesteuerter Calciumkanäle (VGCCs), die den schnellen Zufluss von Calcium entlang seines elektrochemischen Gradienten ermöglichen. Calcium stimuliert weiterhin die Exozytose durch Bindung an Synaptotagmin 1. Es wurde jedoch gezeigt, dass SNAP-25 die VGCC-Funktion in glutamatergen neuronalen Zellen negativ reguliert. SNAP-25 führt zu einer Verringerung der Stromdichte durch VGCCs und damit zu einer Verringerung der Calciummenge, die das Synaptotagmin bindet, was zu einer Verringerung der neuronalen glutamatergen Exozytose führt. Umgekehrt ermöglicht die Unterexpression von SNAP-25 eine Erhöhung der VGCC-Stromdichte und eine Erhöhung der Exozytose.[25]

Weitere Untersuchungen haben mögliche Zusammenhänge zwischen SNAP-25-Über- / Unterexpression und einer Vielzahl von Gehirnerkrankungen nahegelegt. Bei Aufmerksamkeitsdefizit- / Hyperaktivitätsstörung oder ADHS wurden Polymorphismen am SNAP-25-Genort beim Menschen mit der Krankheit in Verbindung gebracht, was auf eine mögliche Rolle bei ihrer Manifestation hinweist.[26] Dies wird weiter durch heterogene SNAP-25-Knockout-Studien nahegelegt, die an Colobom-mutierten Mäusen durchgeführt wurden und zu phänotypischen Eigenschaften von ADHS führten.[27] Studien haben auch eine Korrelation zwischen SNAP-25-Über- / Unterexpression und dem Auftreten von Schizophrenie gezeigt.[28][29]

Syntaxin und die Habc-Domäne[edit]

Syntaxin besteht aus einer Transmembrandomäne (TMD), einer alpha-helikalen SNARE-Domäne, einer kurzen Linkerregion und der Habc-Domäne, die aus drei alpha-helikalen Regionen besteht. Die SNARE-Domäne in Syntaxin dient als Zielstelle für das Andocken von SNAP-25 und Synaptobrevin, um das für den SNARE-Komplex und die anschließende Fusion erforderliche Vier-Helix-Bündel zu bilden. Die Habc-Domäne dient jedoch als autoinhibitorische Domäne in Syntaxin. Es wurde gezeigt, dass es sich umfaltet und mit der SNARE-Domäne von Syntaxin assoziiert, wodurch ein „geschlossener“ Zustand induziert wird, wodurch eine physikalische Barriere für die Bildung des SNARE-Motivs entsteht. Umgekehrt kann sich die Habc-Domäne wieder von der SNARE-Domäne trennen, so dass Syntaxin frei ist, um sowohl mit SNAP-25 als auch mit Synaptobrevin zu assoziieren.[30]

Syntaxin 1B und leicht freisetzbarer Vesikelpool[edit]

Es gibt eine immense Vielfalt von Syntaxin-Subtypen mit 15 Sorten im menschlichen Genom.[31] Es wurde vermutet, dass Syntaxin1B eine Rolle bei der Regulierung der Anzahl von synaptischen Vesikeln spielt, die für die Exozytose im Axonterminal bereit sind. Dies wird auch als leicht freisetzbarer Pool (RRP) von Vesikeln bezeichnet. Eine Knock-out-Studie im Jahr 2014 zeigte, dass der Mangel an Syntaxin1B zu einer signifikanten Verringerung der RRP-Größe führte.[32]

Viele Neurotoxine wirken sich direkt auf SNARE-Komplexe aus. Toxine wie das Botulinum- und das Tetanus-Toxin wirken auf die SNARE-Komponenten. Diese Toxine verhindern ein ordnungsgemäßes Vesikelrecycling und führen zu einer schlechten Muskelkontrolle, Krämpfen, Lähmungen und sogar zum Tod.

Botulinum-Neurotoxin[edit]

Botulinumtoxin (BoNT) ist eines der wirksamsten Toxine, die jemals entdeckt wurden.[33] Es ist ein proteolytisches Enzym, das SNARE-Proteine ​​in Neuronen spaltet. Seine Proteinstruktur besteht aus zwei Peptiduntereinheiten, einer schweren Kette (100 kDas) und einer leichten Kette (50 kDas), die durch eine Disulfidbindung zusammengehalten werden. Die Wirkung von BoNT folgt einem 4-Stufen-Mechanismus, der die Bindung an die neuronale Membran, Endozytose, Membrantranslokation und Proteolyse von SNARE-Proteinen umfasst.[34]

Ziel-SNARE-Proteine ​​von Botulinum-Neurotoxin (BoNT) und Tetanus-Neurotoxin (TeNT) im Axon-Terminal.[35]

In ihrem Wirkungsmechanismus wird die schwere Kette von BoNT zunächst verwendet, um ihre neuronalen Ziele zu finden und an die Ganglioside und Membranproteine ​​präsynaptischer Neuronen zu binden. Als nächstes wird das Toxin in die Zellmembran endozytiert. Die schwere Kette erfährt eine Konformationsänderung, die für die Translokation der leichten Kette in das Cytosol des Neurons wichtig ist. Nachdem die leichte Kette von BoNT in das Cytosol des Zielneurons gebracht wurde, wird sie schließlich aus der schweren Kette freigesetzt, so dass sie ihre aktiven Spaltstellen auf den SNARE-Proteinen erreichen kann.[34] Die leichte Kette wird durch Reduktion der Disulfidbindung, die die beiden zusammenhält, aus der schweren Kette gelöst. Die Reduktion dieser Disulfidbindung wird durch das NADPH-Thioredoxin-Reduktase-Thioredoxin-System vermittelt.[36] Die leichte Kette von BoNT wirkt als Metalloprotease auf SNARE-Proteinen, die von Zn (II) -Ionen abhängig ist.[37] spalten sie und beseitigen ihre Funktion bei der Exozytose.

Es sind 8 Isotypen von BoNT, BoNT / A – BoNT / H bekannt, die jeweils unterschiedliche spezifische Spaltstellen auf SNARE-Proteinen aufweisen. SNAP25, ein Mitglied der SNARE-Proteinfamilie, das sich in der Zellmembran befindet, wird durch die BoNT-Isotypen A, C und E gespalten. Die Spaltung von SNAP-25 durch diese BoNT-Isotypen hemmt ihre Funktion bei der Bildung des SNARE-Komplexes für die Fusion stark von Vesikeln zur synaptischen Membran. BoNT / C zielt auch auf Syntaxin-1 ab, ein weiteres SNARE-Protein, das sich in der synaptischen Membran befindet. Es degeneriert diese Syntaxin-Proteine ​​mit einem ähnlichen Ergebnis wie bei SNAP-25. Ein drittes SNARE-Protein, Synaptobrevin (VAMP), befindet sich auf Zellvesikeln. VAMP2 wird von den BoNT-Isotypen B, D und F in synaptischen Neuronen angegriffen und gespalten.[33] Die Ziele dieser verschiedenen Isotypen von BoNT sowie Tetanus Neurotoxin (TeNT) sind in der Abbildung rechts dargestellt.

In jedem dieser Fälle verursacht Botulinum-Neurotoxin eine funktionelle Schädigung der SNARE-Proteine, was erhebliche physiologische und medizinische Auswirkungen hat. Durch die Schädigung von SNARE-Proteinen verhindert das Toxin, dass synaptische Vesikel mit der synaptischen Membran fusionieren und ihre Neurotransmitter in den synaptischen Spalt freisetzen. Mit der Hemmung der Neurotransmitterfreisetzung in den synaptischen Spalt können Aktionspotentiale nicht zur Stimulierung von Muskelzellen propagiert werden. Dies führt zu einer Lähmung der Infizierten und kann in schweren Fällen zum Tod führen. Obwohl die Wirkungen von Botulinum-Neurotoxin tödlich sein können, wurde es auch als therapeutisches Mittel bei medizinischen und kosmetischen Behandlungen verwendet.[38][39]

Tetanus-Neurotoxin[edit]

Aufschlüsselung der Verantwortlichkeiten und Mechanismen der schweren (HC) und leichten Kette (LC) von Tetanus-Neurotoxin: Der HC unterstützt die Bindung von TeNT sowohl an den Gangliosidrezeptor als auch an den Endrezeptor. Sobald sich TeNT im Vesikel im inhibitorischen Interneuronraum befindet, unterstützt der HC die Translokation des LC in das Zytoplasma. Dann hemmt die LC, die durch Zinkendopeptidase-Aktivität gekennzeichnet ist, die Neurotransmission durch Spaltung von Synaptobrevin 1.

Tetanustoxin oder TeNT besteht aus einer schweren Kette (100 kDa) und einer leichten Kette (50 kDa), die durch eine Disulfidbindung verbunden sind. Die schwere Kette ist für die neurospezifische Bindung von TeNT an die Nervenendmembran, die Endozytose des Toxins und die Translokation der leichten Kette in das Cytosol verantwortlich. Die leichte Kette weist eine Zink-abhängige Endopeptidase- oder insbesondere Matrix-Metalloproteinase (MMP) -Aktivität auf, durch die die Spaltung von Synaptobrevin oder VAMP durchgeführt wird.[40]

Damit die leichte Kette von TeNT aktiviert werden kann, muss ein Zinkatom an jedes Toxinmolekül gebunden sein.[41] Wenn Zink gebunden ist, wird die Reduktion der Disulfidbindung hauptsächlich über das NADPH-Thioredoxinreduktase-Thioredoxin-Redoxsystem durchgeführt.[42] Dann ist die leichte Kette frei, um die Gln76-Phe77-Bindung von Synaptobrevin zu spalten.[40] Die Spaltung von Synaptobrevin beeinflusst die Stabilität des SNARE-Kerns, indem verhindert wird, dass dieser in die Konformation mit niedriger Energie eintritt, die das Ziel für die NSF-Bindung ist.[43] Diese Spaltung von Synaptobrevin ist das Endziel von TeNT, und selbst in niedrigen Dosen hemmt das Neurotoxin die Exozytose der Neurotransmitter.

Rolle bei der Freisetzung von Neurotransmittern[edit]

Neurotransmitter werden in leicht freisetzbaren Vesikelpools gespeichert, die im präsynaptischen Terminal eingeschlossen sind. Während der Neurosekretion / Exozytose spielen SNAREs eine entscheidende Rolle beim Andocken, Priming, der Fusion und der Synchronisation der Neurotransmitterfreisetzung in den synaptischen Spalt.

Der erste Schritt bei der synaptischen Vesikelfusion ist das Anbinden, bei dem die Vesikel aus dem Reservepool in physischen Kontakt mit der Membran gebracht werden. An der Membran ist Munc-18 zunächst in einer geschlossenen Struktur an Syntaxin 1A gebunden. Es wird postuliert, dass die Dissoziation von Munc-18 vom Komplex Syntaxin 1A freisetzt, um an die v-SNARE-Proteine ​​zu binden.[44] Der nächste Schritt bei der Freisetzung ist das Andocken von Vesikeln, bei denen sich die v- und t-SNARE-Proteine ​​vorübergehend auf kalziumunabhängige Weise verbinden. Die Vesikel werden dann vorbereitet, wobei die SNARE-Motive eine stabile Wechselwirkung zwischen dem Vesikel und der Membran bilden. Komplexine stabilisieren den vorbereiteten SNARE-Komplex und machen die Vesikel für eine schnelle Exozytose bereit.

Die Spanne der präsynaptischen Membran, die die vorbereiteten Vesikel und die dichte Sammlung von SNARE-Proteinen enthält, wird als aktive Zone bezeichnet. Spannungsgesteuerte Calciumkanäle sind stark um aktive Zonen konzentriert und öffnen sich als Reaktion auf die Membrandepolarisation an der Synapse. Der Zufluss von Kalzium wird durch Synaptotagmin 1 erfasst, das wiederum das Komplexinprotein verdrängt und es dem Vesikel ermöglicht, mit der präsynaptischen Membran zu fusionieren, um den Neurotransmitter freizusetzen. Es wurde auch gezeigt, dass die spannungsgesteuerten Calciumkanäle direkt mit den t-SNAREs-Syntaxin 1A und SNAP-25 sowie mit Synaptotagmin 1 interagieren. Die Wechselwirkungen können die Calciumkanalaktivität hemmen und die umliegenden Moleküle eng aggregieren die Release-Site.[45]

Es gab viele klinische Fälle, die SNARE-Gene mit neuralen Störungen verbinden. Bei einigen schizophrenen Patienten wurde im Hippocampusgewebe ein Mangel an SNAP-25-mRNA beobachtet, ein SNAP-25-Einzelnukleotid-Polymorphismus ist mit Hyperaktivität bei Autismus-Spektrum-Störungen verbunden, und eine Überexpression von SNAP-25B führt zum frühen Auftreten einer bipolaren Störung.[45]

Rolle bei der Autophagie[edit]

Makroautophagie ist ein katabolischer Prozess, bei dem doppelmembrangebundene Organellen, sogenannte Autophagosomen, gebildet werden, die den Abbau von Zellbestandteilen durch Fusion mit Lysosomen unterstützen. Während der Autophagie werden Teile des Zytoplasmas von einer becherförmigen Doppelmembranstruktur umgeben, die als Phagophor bezeichnet wird, und werden schließlich zum Inhalt des vollständig zusammengesetzten Autophagosoms. Die Biogenese von Autophagosomen erfordert die Initiierung und das Wachstum von Phagophoren, ein Prozess, von dem früher angenommen wurde, dass er durch die De-novo-Zugabe von Lipiden abläuft. Jüngste Erkenntnisse deuten jedoch darauf hin, dass die Lipide, die zu den wachsenden Phagophoren beitragen, aus zahlreichen Membranquellen stammen, darunter endoplasmatisches Retikulum, Golgi, Plasmamembran und Mitochondrien.[46] SNAREs spielen eine wichtige Rolle bei der Vermittlung der Vesikelfusion während der Initiierung und Expansion von Phagophoren sowie der Autophagosom-Lysosom-Fusion in den späteren Stadien der Autophagie.

Obwohl der Mechanismus der Phagophorinitiierung bei Säugetieren unbekannt ist, wurden SNAREs durch homotypische Fusion kleiner, mit Clathrin beschichteter Einzelmembranvesikel, die Atg16L, das v-SNARE VAMP7 und seinen Partner t-SNAREs: Syntaxin- enthalten, an der Phagophorbildung beteiligt 7, Syntaxin-8 und VTI1B.[47] In Hefen sind die t-SNAREs Sec9p und Sso2p für die Exozytose erforderlich und fördern das tubulovesikuläre Knospen von Atg9-positiven Vesikeln, die auch für die Biogenese von Autophagosomen erforderlich sind.[48][49] Das Ausschalten einer dieser SNAREs führt zur Akkumulation von kleinen Atg9-haltigen Vesikeln, die nicht fusionieren, wodurch die Bildung der präautophagosomalen Struktur verhindert wird.[49]

Neben der Phagophor-Assemblierung sind SNAREs auch wichtig für die Vermittlung der Autophagosom-Lysosom-Fusion. Bei Säugetieren sind die SNAREs VAMP7, VAMP8 und VTI1B für die Autophagosom-Lysosom-Fusion erforderlich. Dieser Prozess ist bei lysosomalen Speicherstörungen beeinträchtigt, bei denen sich Cholesterin im Lysosom ansammelt und SNAREs in cholesterinreichen Regionen der Membran bindet, wodurch deren Recycling verhindert wird.[50] Kürzlich wurde Syntaxin 17 (STX17) als autophagosomassoziiertes SNARE identifiziert, das mit VAMP8 und SNAP29 interagiert und für die Fusion mit dem Lysosom erforderlich ist.[51] STX17 ist auf der äußeren Membran von Autophagosomen lokalisiert, jedoch nicht auf Phagophoren oder anderen Autophagosomenvorläufern, wodurch verhindert wird, dass sie vorzeitig mit dem Lysosom fusionieren.[51] In Hefen erfordert die Fusion von Autophagosomen mit Vakuolen (dem Hefeäquivalent von Lysosomen) SNAREs und verwandte Proteine ​​wie das Syntaxin-Homolog Vam3, das SNAP-25-Homolog Vam7, die Ras-ähnliche GTPase Ypt7 und das NSF-Ortholog Sec18.[46]

Verweise[edit]

  1. ^ Georgiev, Danko D; James F. Glazebrook (2007). „Subneuronale Informationsverarbeitung durch Einzelwellen und stochastische Prozesse“. In Lyshevski, Sergey Edward (Hrsg.). Handbuch zur Nano- und Molekularelektronik. Nano- und Microengineering-Serie. CRC Drücken Sie. S. 17–1–17–41. doi:10.1201 / 9781420008142.ch17 (inaktiv 2020-12-04). ISBN 978-0-8493-8528-5.CS1-Wartung: DOI ab Dezember 2020 inaktiv (Link)
  2. ^ Burri, Lena; Lithgow, Trevor (2004-01-01). „Ein vollständiger Satz von SNAREs in Hefe“. Der Verkehr. 5 (1): 45–52. doi:10.1046 / j.1600-0854.2003.00151.x. ISSN 1398-9219. PMID 14675424. S2CID 45480417.
  3. ^
    Gerald K (2002). Zell- und Molekularbiologie (4. Aufl.). John Wiley & Sons.
  4. ^ Malsam J, Söllner TH (1. Oktober 2011). „Organisation von SNAREs innerhalb des Golgi-Stacks“. Cold Spring Harbor Perspektiven in der Biologie. 3 (10): a005249. doi:10.1101 / cshperspect.a005249. PMC 3179334. PMID 21768609.
  5. ^ Hong W, Lev S (Januar 2014). „Anbindung der SNARE-Komplexe“. Trends in der Zellbiologie. 24 (1): 35–43. doi:10.1016 / j.tcb.2013.09.006. PMID 24119662.
  6. ^ Martens S, McMahon HT (21. Mai 2008). „Mechanismen der Membranfusion: unterschiedliche Akteure und gemeinsame Prinzipien“. Nature Reviews Molekulare Zellbiologie. 9 (7): 543–556. doi:10.1038 / nrm2417. PMID 18496517. S2CID 706741.
  7. ^ Hu C, Ahmed M, Melia TJ, Söllner TH, Mayer T, Rothman JE (13. Juni 2003). „Fusion von Zellen durch gespiegelte SNAREs“. Wissenschaft. 300 (5626): 1745–1749. doi:10.1126 / science.1084909. PMID 12805548. S2CID 18243885.
  8. ^
    Sutton RB, Fasshauer D., Jahn R., Brunger AT (1998). „Kristallstruktur eines SNARE-Komplexes, der an der synaptischen Exozytose beteiligt ist, bei einer Auflösung von 2,4 Å“. Natur. 395 (6700): 347–353. doi:10.1038 / 26412. PMID 9759724. S2CID 1815214.
  9. ^ Fasshauer D., Sutton RB, Brunger AT, Jahn R. (1998). „Konservierte Strukturmerkmale des synaptischen Fusionskomplexes: SNARE-Proteine, klassifiziert als Q- und R-SNAREs“. Verfahren der Nationalen Akademie der Wissenschaften. 95 (26): 15781–15786. doi:10.1073 / pnas.95.26.15781. PMC 28121. PMID 9861047.
  10. ^ ein b Burkhardt P., Hattendorf DA, Weis WI, Fasshauer D. (2008). „Munc18a steuert die SNARE-Assemblierung durch seine Wechselwirkung mit dem Syntaxin-N-Peptid“. EMBO J.. 27 (7): 923–33. doi:10.1038 / emboj.2008.37. PMC 2323264. PMID 18337752.
  11. ^ ein b Südhof TC, Rothman JE (Januar 2009). „Membranfusion: Auseinandersetzung mit SNARE- und SM-Proteinen“. Wissenschaft. 323 (5913): 474–7. doi:10.1126 / science.1161748. PMC 3736821. PMID 19164740.
  12. ^ Jahn R, Fasshauer D (2012). „Molekulare Maschinen zur Steuerung der Exozytose synaptischer Vesikel“. Natur. 490 (7419): 201–7. doi:10.1038 / nature11320. PMC 4461657. PMID 23060190.
  13. ^ Chen YA, Scheller RH (2001). „SNARE-vermittelte Membranfusion“. Nat. Rev. Mol. Cell Biol. 2 (2): 98–106. doi:10.1038 / 35052017. PMID 11252968. S2CID 205012830.
  14. ^ Wang Y., Dulubova I., Rizo J., Südhof TC (2001). Funktionsanalyse konservierter Strukturelemente in Hefesyntaxin Vam3p. J. Biol. Chem. 276 (30): 28598–605. doi:10.1074 / jbc.M101644200. PMID 11349128.
  15. ^ Kiessling V, Tamm LK (Januar 2003). „Messung von Abständen in unterstützten Doppelschichten mittels Fluoreszenzinterferenzkontrastmikroskopie: Polymerträger und SNARE-Proteine“. Biophysical Journal. 84 (1): 408–18. doi:10.1016 / s0006-3495 (03) 74861-9. PMC 1302622. PMID 12524294.
  16. ^ Risselada HJ, Kutzner C, Grubmüller H (2. Mai 2011). „Auf frischer Tat ertappt: Visualisierung von SNARE-vermittelten Fusionsereignissen im molekularen Detail“. ChemBioChem: Ein europäisches Journal für chemische Biologie. 12 (7): 1049–55. doi:10.1002 / cbic.201100020. hdl:11858 / 00-001M-0000-0027-C8EA-9. PMID 21433241. S2CID 14140718.
  17. ^ Fang Q, Lindau M (2014). „Wie könnten SNARE-Proteine ​​eine Fusionspore öffnen?“. Physiologie. 29 (4): 278–85. doi:10.1152 / physiol.00026.2013. PMC 4103061. PMID 24985331.
  18. ^ Zucker, Robert S.; Kullmann, Dimitri M.; Kaeser, Pascal S. (August 2014). „Kapitel 15: Freisetzung von Neurotransmittern“. In Byrne, John H.; Heidelberger, Ruth; Waxham, M. Neal (Hrsg.). Von Molekülen zu Netzwerken: Eine Einführung in die zellulären und molekularen Neurowissenschaften. Akademische Presse. S. 443–488. ISBN 9780123982674.
  19. ^ Risselada HJ, Grubmüller H (April 2012). „Wie SNARE-Moleküle die Membranfusion vermitteln: aktuelle Erkenntnisse aus molekularen Simulationen“. Aktuelle Meinung in der Strukturbiologie. 22 (2): 187–96. doi:10.1016 / j.sbi.2012.01.007. hdl:11858 / 00-001M-0000-000F-9AF7-9. PMID 22365575.
  20. ^ Söllner T., Bennett MK, Whiteheart SW, Scheller RH, Rothman JE (1993). „Ein Protein-Assemblierungs-Disassemblierungs-Weg in vitro, der aufeinanderfolgenden Schritten des Andockens, der Aktivierung und der Fusion von synaptischen Vesikeln entsprechen kann“. Zelle. 75 (3): 409–18. doi:10.1016 / 0092-8674 (93) 90376-2. PMID 8221884. S2CID 26906457.
  21. ^ Bock, LV; Woodbury, DJ (9. August 2010). „Chemomechanische Regulation von SNARE-Proteinen, die mit molekulardynamischen Simulationen untersucht wurden“. Biophysical Journal. 99 (4): 1221–1230. doi:10.1016 / j.bpj.2010.06.019. PMC 2920728. PMID 20713006.
  22. ^ Greaves, Jennifer (5. April 2009). „Regulierung des SNAP-25-Handels und der SNAP-25-Funktion durch Palmitoylierung“. Transaktionen der Biochemical Society. 38 (Teil 1): 163–166. doi:10.1042 / BST0380163. PMID 20074052. S2CID 17636112.
  23. ^ Greaves, Jennifer (11. Mai 2010). Palmitoylierung der SNAP-25-Proteinfamilie: Spezifität und Regulation durch DHHC-Palmitoyltransferasen. Das Journal of Biological Chemistry. 285 (32): 24629–24638. doi:10.1074 / jbc.M110.119289. PMC 2915699. PMID 20519516.
  24. ^ Greaves, Jennifer (5. April 2009). „Regulierung des SNAP-25-Handels und der SNAP-25-Funktion durch Palmitoylierung“. Transaktionen der Biochemical Society. 38 (Teil 1): 163–166. doi:10.1042 / bst0380163. PMID 20074052. S2CID 17636112.
  25. ^ Condliffe, Steven B (3. Juni 2010). „Endogenes SNAP-25 reguliert native spannungsgesteuerte Calciumkanäle in glutamatergen Neuronen“. Das Journal of Biological Chemistry. 285 (32): 24968–24976. doi:10.1074 / jbc.M110.145813. PMC 2915732. PMID 20522554.
  26. ^ Corradini, Irene (21. Januar 2009). „SNAP-25 bei neuropsychiatrischen Störungen“. Annalen der New Yorker Akademie der Wissenschaften. 1152: 93–99. doi:10.1111 / j.1749-6632.2008.03995.x. PMC 2706123. PMID 19161380.
  27. ^ Hess, EJ (1992). Spontane lokomotorische Hyperaktivität in einer Mausmutante mit einer Deletion einschließlich des Snap-Gens auf Chromosom 2. Journal of Neuroscience. 12 (7): 2865–2874. doi:10.1523 / JNEUROSCI.12-07-02865.1992. PMC 6575838. PMID 1613559.
  28. ^ Thompson, PM (1998). „Veränderte Spiegel des synaptosomal assoziierten Proteins SNAP-25 bei Schizophrenie“. Biologische Psychiatrie. 43 (4): 239–243. doi:10.1016 / s0006-3223 (97) 00204-7. PMID 9513732. S2CID 20347660.
  29. ^ Gabriel, SM (1997). „Erhöhte Konzentrationen von präsynaptischen Proteinen im cingulären Cortex von Patienten mit Schizophrenie“. Archiv für Allgemeine Psychiatrie. 54 (6): 559–566. doi:10.1001 / archpsyc.1997.01830180077010. PMID 9193197.
  30. ^ MacDonald, Chris (3. April 2009). „Die Autoinhibition der komplexen SNARE-Assemblierung durch einen Konformationsschalter ist ein konserviertes Merkmal von Syntaxinen.“. Transaktionen der Biochemical Society. 38 (Pt 1): 209–212. doi:10.1042 / BST0380209. PMC 5242387. PMID 20074061.
  31. ^ Teng, Felicia Yu Hsuan (24. Oktober 2001). „Das Syntaxin“. Genombiologie. 2 (11): Übersichten 3012.1–7. doi:10.1186 / gb-2001-2-11-reviews3012. PMC 138984. PMID 11737951.
  32. ^ Mishima, Tatsuya (28. Februar 2014). „Syntaxin 1B, aber nicht Syntaxin 1A, ist für die Regulation der Exozytose synaptischer Vesikel und des leicht freisetzbaren Pools an zentralen Synapsen notwendig.“. PLUS EINS. 9 (2): e90004. doi:10.1371 / journal.pone.0090004. PMC 3938564. PMID 24587181.
  33. ^ ein b Peng L., Liu H., Ruan H., Tepp WH, Stoothoff WH, Brown RH, Johnson EA, Yao WD, Zhang SC, Dong M. (12. Februar 2013). „Die Zytotoxizität von Botulinum-Neurotoxinen zeigt eine direkte Rolle von Syntaxin 1 und SNAP-25 beim Überleben von Neuronen.“. Naturkommunikation. 4: 1472. doi:10.1038 / ncomms2462. PMC 4052923. PMID 23403573.
  34. ^ ein b Rossetto O., Pirazzini M., Bolognese P., Rigoni M., Montecucco C. (Dezember 2011). „Ein Update zum Wirkungsmechanismus von Tetanus- und Botulinum-Neurotoxinen“ (PDF). Acta Chim Slov. 58 (4): 702–7. PMID 24061118.
  35. ^ Barr JR, Moura H., Boyer AE, Woolfitt AR, Kalb SR, Pavlopoulos A., McWilliams LG, Schmidt JG, Martinez RA, Ashley DL (2005). „Nachweis und Differenzierung von Botulinum-Neurotoxinen durch Massenspektrometrie“. Neu auftretende Infektion. Dis. 11 (10): 1578–83. doi:10.3201 / eid1110.041279. PMC 3366733. PMID 16318699.
  36. ^ Pirazzini M., Bordin F., Rossetto O., Shone CC, Binz T., Montecucco C. (Januar 2013). „Das Thioredoxinreduktase-Thioredoxin-System ist am Eintritt von Tetanus- und Botulinum-Neurotoxinen in das Cytosol von Nerventerminals beteiligt.“ FEBS Briefe. 587 (2): 150–155. doi:10.1016 / j.febslet.2012.11.007. PMID 23178719. S2CID 207713815.
  37. ^ Silvaggi NR, Wilson D., Tzipori S., Allen KN (Mai 2008). „Katalytische Eigenschaften des Botulinum-Neurotoxins Eine leichte Kette, die durch die hochauflösende Struktur eines inhibitorischen Peptidkomplexes entdeckt wurde“. Biochemie. 47 (21): 5736–5745. doi:10.1021 / bi8001067. PMID 18457419.
  38. ^ Wheeler AH (1998). „Botulinumtoxin A, Zusatztherapie bei refraktären Kopfschmerzen im Zusammenhang mit perikranieller Muskelspannung“. Kopfschmerzen. 38 (6): 468–71. doi:10.1046 / j.1526-4610.1998.3806468.x. PMID 9664753. S2CID 12581048.
  39. ^ Garcia A, Fulton JE (1996). „Kosmetische Denervierung der Muskeln des Gesichtsausdrucks mit Botulinumtoxin. Eine Dosis-Wirkungs-Studie“. Dermatol Surg. 22 (1): 39–43. doi:10.1111 / j.1524-4725.1996.tb00569.x. PMID 8556256. S2CID 7703818.
  40. ^ ein b Schiavo G., Benfenati F., Poulain B., Rossetto O., Polverino de Laureto P., DasGupta BR, Montecucco C. (29. Oktober 1992). „Tetanus- und Botulinum-B-Neurotoxine blockieren die Neurotransmitterfreisetzung durch proteolytische Spaltung von Synaptobrevin“. Natur. 359 (6398): 832–5. doi:10.1038 / 359832a0. PMID 1331807. S2CID 4241066.
  41. ^ Schiavo G., Poulain B., Rossetto O., Benfenati F., Tauc L., Montecucco C. (Oktober 1992). „Tetanustoxin ist ein Zinkprotein und seine Hemmung der Neurotransmitterfreisetzung und der Proteaseaktivität hängt von Zink ab.“. Das EMBO Journal. 11 (10): 3577–83. doi:10.1002 / j.1460-2075.1992.tb05441.x. PMC 556816. PMID 1396558.
  42. ^ Pirazzini M., Bordin F., Rossetto O., Shone CC, Binz T., Montecucco C. (2013). „Das Thioredoxinreduktase-Thioredoxin-System ist am Eintritt von Tetanus- und Botulinum-Neurotoxinen in das Cytosol von Nerventerminals beteiligt.“ FEBS Lett. 587 (2): 150–5. doi:10.1016 / j.febslet.2012.11.007. PMID 23178719. S2CID 207713815.
  43. ^ Pellegrini LL, O’Connor V., Lottspeich F., Betz H. (2. Oktober 1995). „Clostridiale Neurotoxine beeinträchtigen die Stabilität eines energiearmen SNARE-Komplexes, der die NSF-Aktivierung der synaptischen Vesikelfusion vermittelt.“. Das EMBO Journal. 14 (19): 4705–13. doi:10.1002 / j.1460-2075.1995.tb00152.x. PMC 394567. PMID 7588600.
  44. ^ Shi L., Kümmel D., Coleman J., Melia T. J., Giraudo CG (November 2011). „Die Doppelrolle von Munc18-1 beruht auf unterschiedlichen Bindungsmodi des zentralen Hohlraums mit dem Stx1A- und SNARE-Komplex.“. Molekularbiologie der Zelle. 22 (21): 4150–60. doi:10.1091 / mbc.e11-02-0150. PMC 3204075. PMID 21900493.
  45. ^ ein b Ramakrishnan NA, Drescher MJ, Drescher DG (Mai 2012). „Der SNARE-Komplex in neuronalen und sensorischen Zellen“. Molekulare und zelluläre Neurowissenschaften. 50 (1): 58–69. doi:10.1016 / j.mcn.2012.03.009. PMC 3570063. PMID 22498053.
  46. ^ ein b Moreau K., Ravikumar B., Renna M., Puri C., Rubinsztein DC (Juli 2011). „Die Reifung des Autophagosomenvorläufers erfordert eine homotypische Fusion“. Zelle. 146 (2): 303–317. doi:10.1016 / j.cell.2011.06.023. PMC 3171170. PMID 21784250.
  47. ^ Ravikumar B., Moreau K., Jahreiss L., Puri C., Rubinsztein DC (18. Juli 2010). „Die Plasmamembran trägt zur Bildung von präautophagosomalen Strukturen bei“. Naturzellbiologie. 12 (8): 747–757. doi:10.1038 / ncb2078. PMC 2923063. PMID 20639872.
  48. ^ Abeliovich, Hagai (1999). Das Zytoplasma zum Vakuolenhandel mit Aminopeptidase I erfordert einen t-SNARE / Sec1-Komplex, der aus Tlg2 und Vps45 besteht.. EMBO Journal. 18 (21): 6005–6016. doi:10.1093 / emboj / 18.21.6005. PMC 1171666. PMID 10545112.
  49. ^ ein b Nair U, Jotwani A, Geng J, Gammoh N, Richerson D, Yen WL, Griffith J, Nag S, Wang K, Moss T, Baba M, McNew JA, Jiang X, Reggiori F, Melia TJ, Klionsky DJ (Juli 2011) ). „SNARE-Proteine ​​sind für die Makroautophagie erforderlich“. Zelle. 146 (2): 290–302. doi:10.1016 / j.cell.2011.06.022. PMC 3143362. PMID 21784249.
  50. ^ Fraldi A, Annunziata F, Lombardi A, Kaiser HJ, Medina DL, Spampanato C, Fedele AO, Polishchuk R, Sorrentino NC, Simons K, Ballabio A (24. September 2010). „Die lysosomale Fusion und die SNARE-Funktion werden durch die Cholesterinakkumulation bei lysosomalen Speicherstörungen beeinträchtigt.“. Das EMBO Journal. 29 (21): 3607–3620. doi:10.1038 / emboj.2010.237. PMC 2982760. PMID 20871593.
  51. ^ ein b Itakura E, Kishi-Itakura C, Mizushima N (Dezember 2012). „Das schwanzverankerte SNARE-Syntaxin 17 vom Haarnadeltyp zielt auf Autophagosomen zur Fusion mit Endosomen / Lysosomen ab.“. Zelle. 151 (6): 1256–1269. doi:10.1016 / j.cell.2012.11.001. PMID 23217709.

Externe Links[edit]


Eva (DC Comics) – Wikipedia

Vorabend ist eine fiktive Figur aus dem DC Comics-Universum. Sie basiert auf der biblischen Eva, der Mutter der Menschheit und Frau Adams innerhalb der biblischen Erzählung im Buch Genesis, während sie insgesamt eine neue und andere Figur ist. Sie wurde als originelle Horror-Moderatorin für die Publikationsfirma dargestellt. [1] Sie wird als Mutter von Kain und Abel dargestellt, obwohl sie es oft leugnete, und Wer ist wer im DC-Universum? erklärte, dass sie Cousins ​​waren. Sie würde von Vertigo Comics wiederbelebt werden, wobei ihr Charakter als Teil des Träumens wieder verbunden würde.[2][3] Sie ist eine von vier wiederkehrenden Gastgebern von Horror- / Suspense-Anthologien, die in wiederbelebt wurden Der Sandmann das sind Teil des Träumens, wobei die anderen Kain, Abel und Lucien sind.[4]

Sie gab ihr erstes Live-Action-Debüt in Luzifer porträtiert von Inbar Lavi.

Publikationsgeschichte[edit]

Eva erschien ursprünglich in Geheimnisse des finsteren Hauses # 6 (August – September 1972); Sie war die Hauptmoderatorin der Serie, oft auf Lager, normalerweise mit ihrem Raben.[5] Nach Ausgabe 15, in der Eve in der Briefspalte verrät, dass ihr Rabe Edgar Allen [sic], ist ein verzauberter verstorbener Mensch, Herausgeber Joe Orlando verließ die Serie und sie auch, die Serie, die sich auf „finstere Häuser“ konzentriert.[6] In diesem Monat (Dezember 1973) begann sie, eine Geschichte pro Monat in zu hosten Seltsame Rätselgeschichten. [7][8]

Sie wurde der Hauptwirt von Seltsame Rätselgeschichten mit Ausgabe Nr. 15 wird Destiny ersetzt, das zu umgezogen ist Geheimnisse des Spukhauses als Hauptwirt. [9] Im Plumpsen!, Eva, Kain und Abel erzählen jeweils eine Geschichte pro Ausgabe. Sie macht auch ein paar Auftritte in Haus des Geheimnisses und Haus der Geheimnisse. [10]

Im Seltsame Rätselgeschichten # 3 (November – Dezember 1972) bestand Destiny darauf, dass Eva, Kain und Abel nicht ihre biblischen Eponyme sind. Wenn sie gezeigt wird Sandmann # 2, Luciens Kommentar über sie spricht ihre unfreundliche Natur vor Dreams Rückkehr an und besagt, dass sie sich auf Albträume beschränkt.

Fiktive Charakterbiographie[edit]

In originalen Horrorgeschichten[edit]

Eva wird zuerst als Horror-Gastgeberin für die Leser dargestellt, und ihr allererster Auftritt beschreibt ihre Geschichten als zu schrecklich, selbst für ihre beiden Söhne (Kain und Abel), die ihr bei der Erstellung der Publikationsgeschichte vorausgingen.

In ihren frühen Auftritten tritt sie nur als alte Frau auf, wird oft als Hexe identifiziert und neigt zu scharfer Sprache. Bei ihrem ersten Auftritt macht sie Kain und Abel Angst und schreit sie an: „Verlasse die Küche, wenn es zu heiß wird, du feige Sterbliche! Old Eve ist das egal …“ Ihre Briefspalte, die in beantwortet wurde Charakter, wurde „Witch’s Tales“ genannt. Sie trat als Hauptfigur in Geschichten auf Geheimnisse des finsteren Hauses # 9 und # 11 und Seltsame Rätselgeschichten # 18. In Ausgabe 9 bleibt sie in einem Wohnhaus unter einem angenommenen Namen (sie bestreitet, dass sie es in der Briefspalte von Ausgabe 13 ist), wo der Geruch ihrer Küche ihren Nachbarn veranlasst, sie dem Superintendenten zu melden, und sie flucht der Nachbar wiederholt einen Tag – der wunderbar beginnt und in zwei Todesfällen endet – immer und immer wieder.

Im Der Sandmann Comics[edit]

Eva lebt in einer Höhle im Träumen und wird oft von Dreams Rabe begleitet. Der erste Rabe, Lucien, brachte ihr bei, wie man Abel begräbt, nachdem Kain ihn ermordet hatte und sie seitdem von einem Raben begleitet wird. Sie ist freundlich und mütterlicherseits, obwohl sie ihre scharfe Sprache behält. Meistens tritt sie als schwarzhaarige Frau unbestimmten Alters auf; aber manchmal erscheint eine junge, attraktive Jungfrau, eine Mutter mittleren Alters oder eine ältere Frau. Als wir sie zum ersten Mal sehen Der Sandmann # 2, sie sieht ein wenig anders aus als ihre ursprünglichen Erscheinungen. Als nächstes hat sie in # 24 viel zugenommen, ein freundlicheres Gesicht und zeigt ihre Fähigkeit zu altern, wenn sie Matthew umarmt. Ihr größter Auftritt ist in # 40, wo sie zum ersten Mal jung und schön erscheint.[3]

In anderen Medien[edit]

Eva tritt als Hauptfigur in auf Luzifer porträtiert von Inbar Lavi. [11][12][13] Dargestellt als Antagonist und eines der Liebesinteressen des Titelcharakters. [14] Die ursprüngliche Veröffentlichung beschrieb sie als „die ursprüngliche Sünderin selbst“ und „die erste Liebe“ Luzifers.[15] Lavi sprach über ihre Rolle als Charakter und sagte: „Ich persönlich denke, das Interessanteste an Eva war das Konzept der Sünde und wie sie als die ursprüngliche Sünderin angesehen wird. Aber ich sehe das nicht wirklich so. Eva ist mutig genug dazu Gehen Sie ihrer Neugier und ihrer Leidenschaft nach und für mich ist das sehr mutig. Ich habe sie nicht als jemanden gespielt, der einen Fehler gemacht hat. Ich habe sie als jemanden gespielt, der sehr neugierig und aufgeregt ist zu lernen. “ [16]

Rezeption[edit]

Bibek Bhattacharya von Minze fühlte, dass die Hintergrundgeschichten von DCs wichtigsten biblisch angepassten Charakteren (Kain, Abel und Eva) aus Der Sandmann wurden gut erzählt und meinten, dass sie noch interessanter waren als die ursprünglichen biblischen Geschichten, die im Buch Genesis selbst erzählt wurden.[17]

Verweise[edit]

  1. ^ Wallace, Dan (2008), Dougall, Alastair (Hrsg.), Die DC Comics Encyclopedia, New York: Dorling Kindersley, ISBN 978-0-7566-4119-1, OCLC 213309017
  2. ^ „Ein Leitfaden für Nicht-Neil Gaiman-Geschichten im ‚Sandman‘-Universum“. WMQ Comics. 2018-03-05. Abgerufen 2020-11-18.
  3. ^ ein b „Der“ Außenseiter „: Neil Gaiman und das Alte Testament“. Der kreative Prozess. Abgerufen 2020-11-18.
  4. ^ Gaiman, Neil. „Die Lucien-Frage zu Jeopardy heute Abend“. Tumblr. Abgerufen 18. November 2020.
  5. ^ Säcke, Jason; Dallas, Keith (2014). American Comic Book Chronicles: Die 1970er Jahre. TwoMorrows Publishing. p. 55. ISBN 978-1605490564.
  6. ^ Geheimnisse des finsteren Hauses # 16
  7. ^ Clough, Rob (6. August 2020). „DCs Sandman erklärt“. Looper.com. Abgerufen 18. November 2020.
  8. ^ Schedeen, Jesse. „Die Sandmann-Retrospektive“. IGN. Abgerufen 26. November 2020.
  9. ^ Thompson, Steven (Februar 2015). „Das waren seltsame Zeiten: Seltsame Rätselgeschichten„. Frühere Ausgabe!. Raleigh, North Carolina: TwoMorrows Publishing (78): 23–30.
  10. ^ Cassell, Dewey (April 2007). „Der höllische Humor von Plumpsen!„. Frühere Ausgabe!. TwoMorrows Publishing (21): 21–27.
  11. ^ Liu, Narayan (22. August 2020). „Luzifer: Wo passt Eva in Staffel 5?“. CBR. Abgerufen 18. November 2020.
  12. ^ Potier, Laura (28. Juli 2020). „Luzifer: Jede biblische Figur (einschließlich Michael) erklärt“. ScreenRant. Abgerufen 18. November 2020.
  13. ^ Kanzler Agard. „“Luzifers erster Blick auf die letzte Staffel: Inbar Lavis Eva kehrt auf exklusivem Foto zurück „. EW.com.
  14. ^ Vinney, Cynthia (8. Juni 2019). „Luzifer: 5 Gründe, warum wir Team Eve sind (und 5 Gründe, warum wir Team Chloe sind)“. ScreenRant. Abgerufen 26. November 2020.
  15. ^ Holbrook, Damian. „Aufregende Eva! ‚Luzifer‘ besetzt Inbar Lavi als First Lady of Eden“. TV Insider. Abgerufen 26. November 2020.
  16. ^ „INBAR LAVI [LUCIFER]““. Ein Buch des Magazins. Abgerufen 26. November 2020.
  17. ^ Bhattacharya, Bibek (22. November 2020). „Sunday Lounge: Neil Gaiman über das Schreiben von ‚The Sandman‘ und der neuen Netflix-Serie“. Mintlounge. Abgerufen 25. November 2020.

Externe Links[edit]


Ising Modell – Wikipedia

Mathematisches Modell des Ferromagnetismus in der statistischen Mechanik

Das Ising Modell (; Deutsche: [ˈiːzɪŋ]), benannt nach dem Physiker Ernst Ising, ist ein mathematisches Modell des Ferromagnetismus in der statistischen Mechanik. Das Modell besteht aus diskreten Variablen, die magnetische Dipolmomente von Atomen darstellen „dreht sich“ das kann in einem von zwei Zuständen sein (+1 oder −1). Die Drehungen sind in einem Diagramm angeordnet, normalerweise in einem Gitter (wobei sich die lokale Struktur periodisch in alle Richtungen wiederholt), sodass jede Drehung mit ihren Nachbarn interagieren kann. Übereinstimmende benachbarte Drehungen haben eine geringere Energie als nicht übereinstimmende. Das System tendiert zur niedrigsten Energie, aber Wärme stört diese Tendenz und schafft so die Möglichkeit unterschiedlicher Strukturphasen. Das Modell ermöglicht die Identifizierung von Phasenübergängen als vereinfachtes Modell der Realität. Das zweidimensionale Ising-Modell mit quadratischem Gitter ist eines der einfachsten statistischen Modelle zur Darstellung eines Phasenübergangs.[1]

Das Ising-Modell wurde vom Physiker Wilhelm Lenz (1920) erfunden, der es seinem Schüler Ernst Ising als Problem gab. Das eindimensionale Ising-Modell wurde von Ising (1925) selbst in seiner Arbeit von 1924 gelöst;[2] es hat keinen Phasenübergang. Das zweidimensionale Ising-Modell mit quadratischem Gitter ist viel schwieriger und wurde erst viel später von Lars Onsager (1944) analytisch beschrieben. Es wird normalerweise durch eine Transfermatrixmethode gelöst, obwohl es verschiedene Ansätze gibt, die eher mit der Quantenfeldtheorie zusammenhängen.

Bei Dimensionen größer als vier wird der Phasenübergang des Ising-Modells durch die mittlere Feldtheorie beschrieben.

Das Modell selbst ist ein mittleres Feldmodell, dh die Interaktion zwischen zwei beliebigen Spins ist ungefähr unabhängig von den räumlichen Positionen dieser Spins. Diese Annahme wird auferlegt, um das Studium des Modells zu vereinfachen. Es stellt sich heraus, dass das Modell weitaus schwieriger zu untersuchen ist, wenn man stattdessen die räumlichen Orte einbeziehen möchte (über einen Spin-Spin-Interaktionsparameter, der beispielsweise mit zunehmendem Abstand zwischen den Spins abnimmt). Dies rechtfertigt die oben erwähnte vereinfachende Annahme, insbesondere angesichts der Tatsache, dass die strengen mathematischen Ergebnisse zu diesem Modell erst vor kurzem vorliegen.[3]

Das Ising-Problem ohne externes Feld kann äquivalent als Graph-Maximum-Cut-Problem (Max-Cut) formuliert werden, das durch kombinatorische Optimierung gelöst werden kann.

Definition[edit]

Betrachten Sie eine Menge Λ von Gitterplätzen, von denen jede einen Satz benachbarter Stellen (z. B. einen Graphen) bildet d-dimensionales Gitter. Für jede Gitterstelle k ∈ ∈ es gibt eine diskrete Variable σk so dass σk ∈ {+1, −1}, repräsentiert den Spin der Site. EIN Spin-Konfiguration, σ = (σk)k ∈ ∈ ist eine Zuordnung des Spinwerts zu jeder Gitterstelle.

Für zwei beliebige benachbarte Standorte ich, j ∈ ∈ da ist ein Interaktion J.ij. Auch eine Seite j ∈ ∈ hat eine externes Magnetfeld hj damit interagieren. Das Energie einer Konfiguration σ ist durch die Hamilton-Funktion gegeben

Dabei liegt die erste Summe über Paaren benachbarter Spins (jedes Paar wird einmal gezählt). Die Notation ⟨ij⟩ Zeigt an, dass Websites ich und j sind nächste Nachbarn. Das magnetische Moment ist gegeben durch µ. Es ist zu beachten, dass das Vorzeichen im zweiten Term des obigen Hamilton-Operators tatsächlich positiv sein sollte, da das magnetische Moment des Elektrons antiparallel zu seinem Spin ist, der negative Term jedoch konventionell verwendet wird.[4] Das Konfigurationswahrscheinlichkeit ist gegeben durch die Boltzmann-Verteilung mit inverser Temperatur β ≥ 0:

wobei β = (kB.T.)−1und die Normalisierungskonstante

ist die Partitionsfunktion. Für eine Funktion f der Spins („beobachtbar“) bezeichnet man mit

der Erwartungswert (Mittelwert) von f.

Die Konfigurationswahrscheinlichkeiten P.β(σ) stellen die Wahrscheinlichkeit dar, dass sich das System (im Gleichgewicht) in einem Zustand mit der Konfiguration σ befindet.

Diskussion[edit]

Das Minuszeichen für jeden Term der Hamilton-Funktion H.(σ) ist konventionell. Unter Verwendung dieser Vorzeichenkonvention können Ising-Modelle nach dem Vorzeichen der Interaktion klassifiziert werden: wenn für ein Paar ich, j

Das System wird als ferromagnetisch oder antiferromagnetisch bezeichnet, wenn alle Wechselwirkungen ferromagnetisch oder alle antiferromagnetisch sind. Die ursprünglichen Ising-Modelle waren ferromagnetisch, und es wird immer noch oft angenommen, dass „Ising Modell“ bedeutet ein ferromagnetisches Ising-Modell.

In einem ferromagnetischen Ising-Modell möchten Spins ausgerichtet werden: Die Konfigurationen, bei denen benachbarte Spins das gleiche Vorzeichen haben, haben eine höhere Wahrscheinlichkeit. In einem antiferromagnetischen Modell neigen benachbarte Spins dazu, entgegengesetzte Vorzeichen zu haben.

Die Zeichenkonvention von H.(σ) erklärt auch, wie eine Spinstelle j interagiert mit dem externen Feld. Die Spinstelle möchte nämlich mit dem externen Feld ausgerichtet sein. Wenn:

Vereinfachungen[edit]

Ising-Modelle werden häufig untersucht, ohne dass ein externes Feld mit dem Gitter interagiert, d. H. h = 0 für alle j im Gitter Λ. Mit dieser Vereinfachung wird der Hamiltonianer

Wenn das externe Feld überall Null ist, h = 0, das Ising-Modell ist symmetrisch, wenn der Wert des Spins an allen Gitterplätzen umgeschaltet wird; Ein Feld ungleich Null unterbricht diese Symmetrie.

Eine weitere häufige Vereinfachung ist die Annahme, dass alle nächsten Nachbarn ⟨ij⟩ Haben die gleiche Wechselwirkungsstärke. Dann können wir einstellen J.ij = J. für alle Paare ich, j in Λ. In diesem Fall wird der Hamilton-Operator weiter vereinfacht

Verbindung zum maximalen Schnitt des Diagramms[edit]

Eine Teilmenge S der Scheitelpunktmenge V (G) eines gewichteten ungerichteten Graphen G bestimmt einen Schnitt des Graphen G in S und seine komplementäre Teilmenge G S. Die Größe des Schnitts ist die Summe der Gewichte der Kanten zwischen S und G S. Eine maximale Schnittgröße ist mindestens die Größe eines anderen Schnitts und variiert S.

Für das Ising-Modell ohne externes Feld in einem Graphen G wird der Hamilton-Operator die folgende Summe über den Graphenkanten E (G)

H.((σ)=– –ichjE.((G)J.ichjσichσj{ displaystyle H ( sigma) = – sum _ {ij in E (G)} J_ {ij} sigma _ {i} sigma _ {j}}

.

Hier ist jeder Scheitelpunkt i des Graphen eine Spinstelle, die einen Spinwert annimmt

σich=±1{ displaystyle sigma _ {i} = pm 1}

. Eine gegebene Spin-Konfiguration

σ{ displaystyle sigma}

partitioniert die Menge der Eckpunkte

V.((G){ displaystyle V (G)}

in zwei

σ{ displaystyle sigma}

-abhängige Untergruppen, solche mit Spin-up

V.+{ displaystyle V ^ {+}}

und diejenigen mit Spin-Down

V.– –{ displaystyle V ^ {-}}

. Wir bezeichnen mit

δ((V.+){ displaystyle delta (V ^ {+})}

das

σ{ displaystyle sigma}

-abhängige Menge von Kanten, die die beiden komplementären Scheitelpunkt-Teilmengen verbindet

V.+{ displaystyle V ^ {+}}

und

V.– –{ displaystyle V ^ {-}}

. Das Größe

|δ((V.+)|{ displaystyle left | delta (V ^ {+}) right |}

des Schnitts

δ((V.+){ displaystyle delta (V ^ {+})}

um zweiteilig zu sein, kann der gewichtete ungerichtete Graph G definiert werden als

|δ((V.+)|=12ichjδ((V.+)W.ichj{ displaystyle left | delta (V ^ {+}) right | = { frac {1} {2}} sum _ {ij in delta (V ^ {+})} W_ {ij} }}

,

wo

W.ichj{ displaystyle W_ {ij}}

bezeichnet ein Gewicht der Kante

ichj{ displaystyle ij}

und die Skalierung 1/2 wird eingeführt, um die Doppelzählung der gleichen Gewichte zu kompensieren

W.ichj=W.jich{ displaystyle W_ {ij} = W_ {ji}}

.

Die Identitäten

H.((σ)=– –ichjE.((V.+)J.ichj– –ichjE.((V.– –)J.ichj+ichjδ((V.+)J.ichj=– –ichjE.((G)J.ichj+2ichjδ((V.+)J.ichj,{ displaystyle { begin {align} H ( sigma) & = – sum _ {ij in E (V ^ {+})} J_ {ij} – sum _ {ij in E (V ^ { -})} J_ {ij} + sum _ {ij in delta (V ^ {+})} J_ {ij} \ & = – sum _ {ij in E (G)} J_ {ij } +2 sum _ {ij in delta (V ^ {+})} J_ {ij}, end {align}}}

wobei die Gesamtsumme im ersten Term nicht davon abhängt

σ{ displaystyle sigma}

implizieren, dass die Minimierung

H.((σ){ displaystyle H ( sigma)}

im

σ{ displaystyle sigma}

ist gleichbedeutend mit Minimierung

ichjδ((V.+)J.ichj{ displaystyle sum _ {ij in delta (V ^ {+})} J_ {ij}}

. Kantengewicht definieren

W.ichj=– –J.ichj{ displaystyle W_ {ij} = – J_ {ij}}

Auf diese Weise wird das Ising-Problem ohne externes Feld in ein Diagramm-Max-Cut-Problem umgewandelt
[5] Maximierung der Schnittgröße

|δ((V.+)|{ displaystyle left | delta (V ^ {+}) right |}

, der wie folgt mit dem Ising Hamiltonian verwandt ist,

H.((σ)=ichjE.((G)W.ichj– –4|δ((V.+)|.{ displaystyle H ( sigma) = sum _ {ij in E (G)} W_ {ij} -4 left | delta (V ^ {+}) right |.}

Fragen[edit]

Eine signifikante Anzahl statistischer Fragen zu diesem Modell befindet sich an der Grenze einer großen Anzahl von Drehungen:

  • Sind in einer typischen Konfiguration die meisten Drehungen +1 oder -1 oder sind sie gleichmäßig aufgeteilt?
  • Wenn ein Spin an einer bestimmten Position ich ist 1, was ist die Wahrscheinlichkeit, dass sich der Spin an der Position befindet j ist auch 1?
  • Wenn β geändert wird, gibt es einen Phasenübergang?
  • Was ist auf einem Gitter Λ die fraktale Dimension der Form eines großen Clusters von +1 Spins?

Grundlegende Eigenschaften und Geschichte[edit]

Visualisierung des translatorisch-invarianten Wahrscheinlichkeitsmaßes des eindimensionalen Ising-Modells

Der am besten untersuchte Fall des Ising-Modells ist das translatorisch-invariante ferromagnetische Nullfeldmodell auf a d-dimensionales Gitter, nämlich Λ = Z.d, J.ij = 1, h = 0.

In seiner Doktorarbeit von 1924 löste Ising das Modell für die d = 1 Fall, der als lineares horizontales Gitter betrachtet werden kann, bei dem jeder Ort nur mit seinem linken und rechten Nachbarn interagiert. In einer Dimension lässt die Lösung keinen Phasenübergang zu.[6] Für jedes positive β sind nämlich die Korrelationen ⟨σichσj⟩ Zerfällt exponentiell in |ich – – j|:

und das System ist ungeordnet. Aufgrund dieses Ergebnisses gelangte er fälschlicherweise zu dem Schluss, dass dieses Modell in keiner Dimension ein Phasenverhalten aufweist.

Das Ising-Modell durchläuft einen Phasenübergang zwischen einer geordneten und einer ungeordneten Phase in zwei oder mehr Dimensionen. Das System ist nämlich für kleines β ungeordnet, während das System für großes β eine ferromagnetische Ordnung aufweist:

Winston L. Prouty – Wikipedia

Amerikanischer Politiker aus Vermont

Winston Prouty

WinstonProuty.jpg
Senator der Vereinigten Staaten
aus Vermont
Im Büro
3. Januar 1959 – 10. September 1971
Vorangegangen von Ralph Flandern
gefolgt von Robert Stafford
Mitglied von
Repräsentantenhaus der Vereinigten Staaten
aus Vermonts At-Large-Distrikt
Im Büro
3. Januar 1951 – 3. Januar 1959
Vorangegangen von Charles Albert Plumley
gefolgt von William H. Meyer
Sprecher des Repräsentantenhauses von Vermont
Im Büro
1947–1949
Vorangegangen von Joseph H. Denny
gefolgt von J. Harold Stacey
Mitglied des Repräsentantenhauses von Vermont aus Newport
Im Büro
1941–1949
Vorangegangen von John M. Bradley
gefolgt von Robert WH Davis
Bürgermeister von Newport, Vermont
Im Büro
1938–1941
Vorangegangen von John M. Bradley
gefolgt von Ona S. Searles
Persönliche Daten
Geboren

Winston Lewis Prouty

((1906-09-01)1. September 1906
Newport, Vermont, USA

Ist gestorben 10. September 1971(1971-09-10) (65 Jahre)
Boston, Massachusetts, USA
Politische Partei Republikaner
Ehepartner Frances C. Hearle Backus (1939-1960, ihr Tod)
Jennette Herbert Hall (1962-1971, sein Tod)
Kinder 3
Bildung Lafayette College
Beruf Geschäftsmann

Winston Lewis Prouty (1. September 1906 – 10. September 1971) war ein amerikanischer Politiker. Als Mitglied der Republikanischen Partei war er von 1959 bis zu seinem Tod Senator der Vereinigten Staaten von Vermont aus. Zuvor war er Mitglied des Repräsentantenhauses der Vereinigten Staaten und diente von 1951 bis 1959 im Kongressbezirk At-Large in Vermont.

Frühes Leben und Ausbildung[edit]

Winston Prouty wurde in Newport, Vermont, als Sohn von Willard Robert und Margaret (geb. Lockhart) Prouty geboren.[1] Seine Familie besaß die Prouty & Miller Lumber Company, ein Holz- und Baustoffunternehmen.[2] Seine Familie engagierte sich auch in der Politik; Sein Vater und sein Großvater waren beide Gesetzgeber, sein Onkel Charles A. Prouty war Mitglied der Interstate Commerce Commission und sein anderer Onkel George H. Prouty war Gouverneur von Vermont (1908–1910).

Er erhielt seine frühe Ausbildung an öffentlichen Schulen in Newport und besuchte das Bordentown Military Institute in New Jersey.[4] Er absolvierte die Hill School im Jahr 1924. Anschließend studierte er am Lafayette College in Easton, Pennsylvania, von dem er 1930 seinen Bachelor of Science erhielt.[5][6][7][8] Während des Studiums war er Mitglied der Delta Upsilon-Bruderschaft.[9]

Frühe Karriere[edit]

Prouty kehrte nach Newport zurück und schloss sich dem Familienunternehmen Prouty & Miller an.[2] Er war auch Direktor der National Bank of Newport und der Associated Industries of Vermont.[4] Obwohl er als schüchtern und zurückhaltend beschrieben wurde, entschied sich Prouty für eine Karriere in der Politik, auch weil er sich des Verlusts seines rechten Daumens bei einem Unfall im Geschäft seiner Familie bewusst war. Als Republikaner war er von 1933 bis 1937 Mitglied des Stadtrats von Newport. Von 1938 bis 1941 war er Bürgermeister von Newport. Er wurde 1940 in das Repräsentantenhaus von Vermont gewählt und diente von 1941 bis 1949. Während seiner letzten Amtszeit Zwei Jahre in der Legislative war er Sprecher des Hauses.[4] Er war ein erfolgloser Kandidat für die republikanische Nominierung zum Vizegouverneur von Vermont im Jahr 1948 und verlor gegen Harold J. Arthur.[4] Von 1949 bis 1950 war er Vorsitzender des State Water Conservation Board.

Kongresskarriere[edit]

Repräsentantenhaus[edit]

1950, nachdem der langjährige Amtsinhaber Charles Albert Plumley beschlossen hatte, nicht mehr zu kandidieren, kündigte Prouty seine Kandidatur für das Repräsentantenhaus der Vereinigten Staaten aus dem Kongressbezirk At-Large in Vermont an.[2] Er gewann die republikanische Nominierung in einem Vier-Wege-Rennen, an dem auch Gouverneur Arthur teilnahm.[4] Bei den allgemeinen Wahlen besiegte er seinen demokratischen Gegner Herbert B. Comings mit einem Vorsprung von 73% bis 26%.[13] Anschließend wurde er für drei weitere Amtszeiten wiedergewählt und erhielt nie weniger als 61% der Stimmen.[14] Während seiner Amtszeit im Repräsentantenhaus war Prouty Mitglied des Veteranenausschusses und des Ausschusses für auswärtige Angelegenheiten des Hauses. Er war ein Verfechter der Schaffung des Saint Lawrence Seaway. Während seiner Amtszeit im Repräsentantenhaus stimmte Prouty für das Civil Rights Act von 1957.[16]

Senat[edit]

Er wurde 1958 in den Senat der Vereinigten Staaten gewählt. Er wurde 1964 und 1970 wiedergewählt und diente vom 3. Januar 1959 bis zu seinem Tod. Im Senat gehörten zu den Aufgaben des Prouty-Ausschusses neben dem Sonderausschuss für das Altern und dem Auswahlausschuss für Kleinunternehmen auch District of Columbia, Regeln, Arbeit und Gemeinwohl sowie Handel. Zu den Themen, mit denen er identifiziert wurde, gehörten staatliche Beihilfen für den Schulbau, die Bundesfinanzierung von Kursen für Schüler mit besonderen Bedürfnissen, Kunst- und Musikunterricht sowie Seniorenbedürfnisse wie die Gesundheitsversorgung und die Ausweitung der Anspruchsberechtigung auf soziale Sicherheit. Darüber hinaus war er ein langjähriger Verfechter der Rückkehr des Personenverkehrs nach Vermont. Als ranghoher Republikaner im District of Columbia-Komitee unterstützte Prouty die Gesetzgebung, die den Delegierten des Distrikts zum Kongress schuf. Während seiner Amtszeit im Senat stimmte Prouty für die Civil Rights Acts von 1960,[21]1964,[22] und 1968,[23] sowie die 24. Änderung der US-Verfassung,[24] das Stimmrechtsgesetz von 1965,[25] und die Bestätigung von Thurgood Marshall vor dem Obersten Gerichtshof der USA.[26]

Tod und Beerdigung[edit]

Prouty starb am 10. September 1971 im New England Deaconess Hospital in Boston an den Folgen von Magenkrebs.[27] Er wurde auf dem Pine Grove Cemetery in Newport beigesetzt.[28]

1939 heiratete Prouty Frances Currie Hearle Backus (1907-1960) aus Stanstead, Quebec, die Mutter von drei Töchtern aus einer früheren Ehe, Currie, Elizabeth und Ann.[29][30] Sie starb 1960 und 1962 heiratete Prouty Jennette Herbert Hall (1913-2002), die der Chefassistent der Kongressabgeordneten Henry J. Latham aus New York und Robert E. Cook aus Ohio gewesen war.[31]

1966 erhielt Prouty den Ehrentitel des LL.D. vom Lafayette College.[8][32]

Siehe auch[edit]

Verweise[edit]

  1. ^ Papst Charles Henry (1910). Prouty (Proute) Genealogie. Boston: CH Papst. p. 173 – über HathiTrust.
  2. ^ ein b c „Hartgesottener Republikaner“. Die New York Times. 1971-09-11.
  3. ^ ein b c d e Aktuelle Biografie. XXI. HW Wilson Company. 1960.
  4. ^ Senat der Vereinigten Staaten (1972). Gedenkadressen: Winston L. Prouty, verstorbener Senator aus Vermont. Washington, DC: Druckerei der US-Regierung. p. VII.
  5. ^ Garraty, John Arthur; Carnes, Mark Christopher (1999). Amerikanische Nationalbiographie. 17. New York, NY: Oxford University Press. p. 910. ISBN 978-0-1952-0635-7.
  6. ^ „Prouty ist Bürgermeister“. Burlington Free Press. Burlington, VT. Associated Press. 2. März 1938. p. 2 – über Newspapers.com.
  7. ^ ein b „Lafayette listet 5 Ehrentitel auf“. Der Morgenruf. Allentown, PA. 26. Mai 1966. p. 41 – über Newspapers.com.
  8. ^ „Politik und Regierung“. Delta Upsilon Michigan Tech Chapter.
  9. ^ „Statistik der Kongresswahlen vom 7. November 1952“ (PDF). Angestellter des Repräsentantenhauses der Vereinigten Staaten.
  10. ^ „Statistik der Kongresswahlen vom 2. November 1954“ (PDF). Angestellter des Repräsentantenhauses der Vereinigten Staaten.
  11. ^ „HR. 6127. CIVIL RIGHTS ACT OF 1957“. GovTrack.us.
  12. ^ „HR. 8601. PASSAGE DER GEÄNDERTEN RECHNUNG“.
  13. ^ „HR. 7152. PASSAGE“.
  14. ^ „Um HR 2516 zu bestehen, eine Rechnung zum Verbot von Diskriminierung beim Verkauf oder zur Vermietung von Wohnungen und zum Verbot von rassistisch motivierten Eingriffen in eine Person, die seine bürgerlichen Rechte ausübt, und für andere Zwecke“.
  15. ^ SJ SJ.. GovTrack.us.
  16. ^ „Um S. 1564, das Wahlrechtsgesetz von 1965, zu bestehen“.
  17. ^ „BESTÄTIGUNG DER NOMINIERUNG VON THURGOOD MARSHALL, DEM ERSTEN NEGRO, DER ZUM SUPREME COURT ERNANNT WURDE“. GovTrack.us.
  18. ^ „Senator Prouty stirbt an Magenkrebs“. Brattleboro Reformer. Brattleboro, VT. United Press International. 11. September 1971. p. 1 – über Newspapers.com.
  19. ^ Führer Andrew (16. September 1971). „Freunde, Staat, nationale Führer Jam Prouty Service“. Burlington Free Press. Burlington, VT. p. 1 – über Newspapers.com.
  20. ^ „Frau von US Sen Prouty, R-Vt., Ist bei 53 von Herzinfarkt tot“. Burlington Free Press. Burlington, VT. 5. Dezember 1960. p. 1 – über Newspapers.com.
  21. ^ „Bestattungsunternehmen heute für Frau Prouty geplant“. Bennington Banner. Bennington, VT. United Press International. 5. Dezember 1960. p. 1 – über Newspapers.com.
  22. ^ „Senator Prouty Mi nach Ohioan in Washington“. Bennington Banner. Bennington, VT. Associated Press. 3. Juli 1962. p. 1 – über Newspapers.com.
  23. ^ Gaines, Barry (13. Mai 1966). „Gouverneur Hatfield spricht bei Commnencement“. Die Lafayette. Easton, PA. p. 1.

Externe Links[edit]


Mosh (Wrestler) – Wikipedia

Amerikanischer Wrestler

Charles Warrington (* 28. Mai 1971 in London) ist ein US-amerikanischer Wrestler, der vor allem für seine Zeit in der World Wrestling Federation bekannt ist. Derzeit tritt er unter dem Ringnamen auf Mosh als die Hälfte des Tag-Teams The Headbangers zusammen mit Thrasher.

Professionelle Wrestling-Karriere[edit]

Frühe Karriere (1992–1996)[edit]

Warrington begann Anfang der neunziger Jahre mit dem Training bei Larry Sharpe und Glenn Ruth. Sein frühestes Eingangsthema war eine Montage, in der er einen Yugo auf den Gehwegen der Winding Way Road in Stratford, New Jersey, fuhr. 1993 trat er mehrfach in der World Wrestling Federation als Verbesserungstalent auf (unter dem Namen Chaz Ware).[2] 1994 tat er sich mit seinem Co-Trainer Glenn Ruth zusammen. Er und Ruth, die als maskiertes Team „the Spiders“ arbeiteten, verloren gegen Axel und Ian Rotten in der ECW. Wrestling unter verschiedenen Namen und Gimmicks.

World Wrestling Federation[edit]

Die Headbanger (1996–1999)[edit]

Zuerst als sie selbst als die Spinnen und dann als die fliegenden Nonnen, mit Warrington als Mutter Smucker und Ruth als Schwester Angelica; Debüt in der Premiere von Shotgun Saturday Night zusammen mit Brother Love im Januar 1997.[3][4][5] Warrington und Ruth waren am bekanntesten als Mosh (Warrington) und Thrasher (Ruth), The Headbangers, ein Paar Metal-Fans, die sich in Kilts kleideten.[6] Sie rangen Ende der 90er Jahre in der World Wrestling Federation (WWF) und veranstalteten 1997 kurz die WWF Tag Team Championship und 1998 die NWA Tag Team Championships.[7][8]

Verschiedene Spielereien (1999)[edit]

Nachdem Thrasher im Mai 1999 eine Knieverletzung erlitten hatte, wurde Warrington umbenannt Biberspaltung, ein Verweis auf die TV-Serie Überlassen Sie es dem Biber. Er erschien in Schwarz-Weiß-Vignetten mit seiner „Mutter“, der üppigen Mrs. Cleavage, und die beiden tauschten sexuelle Anspielungen aus (z. B. würde Mrs. Cleavage Beaver etwas von „Muttermilch“ anbieten, wenn er sich beschwerte, dass sein Müsli trocken sei ).[3] Das Gimmick wurde schnell verschrottet (über eine „Worked Shoot“ -Promo, in der Warrington angeblich den Charakter aufgab) und im Einzelhandel verkauft.[6]

Am 28. Juni nennt sich Warrington jetzt Chaz, verspottete das Gimmick von Beaver Cleavage und identifizierte Mrs. Cleavage in einem Interview im Shooting-Stil als seine Freundin Marianna Komlos.[6] Warrington und Komlos haben sich mit Meat und seinem weiblichen Gefolge gestritten, dann mit Prince Albert.[6] Warrington verließ Komlos in der Folge vom 9. September von Abschmettern!und sie bat ihn, sie die ganze Nacht zurückzunehmen.[6] In der Folge vom 13. September von Roh ist KriegKomlos kam mit einem blauen Auge zum Ring, und es wurde angedeutet, dass Warrington sie geschlagen hatte.[3] In den folgenden Wochen würde Warrington von verschiedenen Wrestlern geschlagen werden und von Beamten, die alle wütend auf Warrington waren, weil sie angeblich Komlos geschlagen hatten, aus den Matches verdrängt werden.[3] Komlos versuchte, Warrington von der Polizei verhaften zu lassen, wurde jedoch durch die Intervention von Thrasher gerettet, der einen Film zeigte, der zeigte, dass Komlos lügte.[3] Komlos wurde verhaftet und die Headbanger wurden reformiert.[3]

Headbangers Reunion und Lo Down (1999–2001)[edit]

Die Headbanger nahmen dann eine Spielerei auf, bei der sie sich als die Gegner verkleiden würden, mit denen sie sich herumschlugen, wie zum Beispiel der Dudley Boyz und die Mean Street Posse. Später drehten sie sich um und zogen sich schleppend an, vor allem mit Brustkegeln.[6] Im Juni 2000 gründete Warrington, wieder bekannt als Chaz, ein neues Tag-Team mit D’Lo Brown, bekannt als Lo Down. Sie hatten nur geringen Erfolg, wurden aber mit Tiger Ali Singh gepaart und erhielten die Spielereien zweier bitterer ethnischer Wrestler, die das Gefühl hatten, festgehalten zu werden. Sie erhielten eine neue Ringkleidung mit Turbanen und Schärpen, verwendeten Tigers Eingangsmusik und erhielten in einer Folge von sogar arabisch klingende Namen Sonntag Nacht Hitze. Die Popularität des Teams schwand schnell; Beim Royal Rumble 2001 wurde beiden ein Platz im Rumble-Match verweigert, da ihr Platz dem Komiker Drew Carey gegeben worden war. Das Team wurde schließlich aus dem Fernsehen genommen und Singh und Warrington wurden freigelassen. Chaz hatte sein letztes WWF-Match am 30. Juli 2001 von Roh ist Krieg in einem dunklen Match das Inferno Kid besiegen.

Unabhängige Schaltung (2001 – heute)[edit]

Mosh und Thrasher traten am 24. Juni 2012 als Masked-Tag-Team Guardians of Truth unter der Leitung von Truth Martini auf dem Pay-per-View-Ring of Honor der Ring of Honor auf. Sie haben gegen die Briscoe Brothers verloren. Später entlarvten sich die beiden und traten als Head Bangers an. Warrington ringt jetzt gelegentlich auf der unabhängigen Rennstrecke in Florida. Warrington spielt auch im Außenfeld des landesweit anerkannten professionellen Kickballteams „The Meatballs“ in Fort Lauderdale.[9] 2013 wechselte er unter dem Spitznamen That Simply Tremendous Dude zu Ring Warriors. Am 14. Oktober 2013 präsentierte er seinen einfach gewaltigen Delegierten Adam Barisano. In der nächsten Woche drehte Warrington die Ferse und besiegte Shooter Storm.

Rückkehr zur WWE (2016)[edit]

Am 26. August 2016 wurde berichtet, dass Mosh und Thrasher als Teil der Marke SmackDown zu WWE zurückkehren würden.[10] Sie haben ihr Rückspiel gegen Heath Slater und Rhyno in der Folge vom 30. August von verloren Abschmettern. Sie kämpften auch gegen die Usos um die Chance, bei der Survivor Series anzutreten, verloren jedoch. The Headbangers erschien am 15. November 2016 in der 900. Folge von SmackDown Live Teaming mit anderen bösartigen Teams.

Andere Medien[edit]

Warrington erschien 1996 im Film Schachtel Mondlicht als „Castroater“.

Meisterschaften und Erfolge[edit]

Verweise[edit]

  1. ^ ein b „Chaz OWW Profil“.
  2. ^ Cawthon, Graham. „WWF 1993“. Die Geschichte der WWE.
  3. ^ ein b c d e f RD Reynolds und Randy Baer (2003). Wrestlecrap – das Schlimmste im Pro Wrestling. ECW Drücken Sie. ISBN 1-55022-584-7.CS1-Wartung: Verwendet den Autorenparameter (Link)
  4. ^ Cawthon, Graham. „WWF 1994“. Die Geschichte der WWE.
  5. ^ Cawthon, Graham. „WWF 1996“. Die Geschichte der WWE.
  6. ^ ein b c d e f Cawthon, Graham (2013). Die Geschichte des professionellen Wrestlings Band 2: WWF 1990 – 1999. CreateSpace Independent Publishing Platform. WIE IN B00RWUNSRS.
  7. ^ ein b Will, Gary; Royal Duncan (1994). „USA: Titel des 19. Jahrhunderts und weithin verteidigte Titel – NWA, WWF, AWA, IWA, ECW: NWA World Tag Team-Titel“. Wrestling Titel Geschichten (3. Aufl.). Archeus Communications. p. 23. ISBN 0-9698161-1-1.
  8. ^ ein b Will, Gary; Royal Duncan (1994). „Vereinigte Staaten: Titel des 19. Jahrhunderts und weithin verteidigte Titel – NWA, WWF, AWA, IWA, ECW: WWF World Tag Team Title“. Wrestling Titel Geschichten (3. Aufl.). Archeus Communications. p. 23. ISBN 0-9698161-1-1.
  9. ^ „2010 Meatballs Team Roster“. Archiviert von das Original am 5. Januar 2010. Abgerufen 16. Juni 2011.
  10. ^ http://www.wrestlingnewsworld.com/headbangers-returning-wwe-dana-white-vince-mcmahon-working-together-wwe-star-kicked-off-airplane-big-ufc-star-bellator/
  11. ^ https://www.cagematch.net//?id=5&nr=3341
  12. ^ http://www.cagematch.net/?id=1&nr=162744
  13. ^ https://www.cagematch.net//?id=1&nr=179645
  14. ^ „GWF Halbschwergewichtsmeisterschaft“. Cagematch. Abgerufen 1. November, 2016.
  15. ^ „NWL Tag Team Championship“. Cagematch. Abgerufen 1. November, 2016.
  16. ^ „Pro Wrestling Illustrated (PWI) 500 für 1997“. Die Internet Wrestling Datenbank. Abgerufen 25. August 2015.
  17. ^ Royal Duncan & Gary Will (2000). Wrestling Titel Geschichten (4. Aufl.). Archeus Communications. ISBN 0-9698161-5-4.

Externe Links[edit]