Opioidpeptid – Wikipedia

before-content-x4

Strukturelle Korrelation zwischen Met-Enkephalin, einem Opioidpeptid, (links) und Morphin, ein Opiat, (rechts)

Opioidpeptide sind Peptide, die an Opioidrezeptoren im Gehirn binden; Opiate und Opioide ahmen die Wirkung dieser Peptide nach. Solche Peptide können vom Körper selbst produziert werden, beispielsweise Endorphine. Die Wirkungen dieser Peptide sind unterschiedlich, aber sie ähneln alle denen von Opiaten. Opioid-Peptid-Systeme des Gehirns spielen bekanntlich eine wichtige Rolle bei Motivation, Emotionen, Bindungsverhalten, der Reaktion auf Stress und Schmerzen und der Kontrolle der Nahrungsaufnahme.

Opioidähnliche Peptide können auch aus teilweise verdauter Nahrung aufgenommen werden (Casomorphine, Exorphine und Rubiscoline). Die opioiden Nahrungspeptide haben eine Länge von typischerweise 4–8 Aminosäuren. Die körpereigenen Opioide sind in der Regel viel länger.

Opioidpeptide werden durch posttranslationale proteolytische Spaltung von Vorläuferproteinen freigesetzt. Die Vorläufer bestehen aus den folgenden Komponenten: einer Signalsequenz, die einer konservierten Region von etwa 50 Resten vorangeht; einen Bereich variabler Länge; und die Sequenz der Neuropeptide selbst. Die Sequenzanalyse zeigt, dass die konservierte N-terminale Region der Vorläufer 6 Cysteine ​​enthält, die wahrscheinlich an der Bildung von Disulfidbindungen beteiligt sind. Es wird spekuliert, dass diese Region für die Neuropeptid-Prozessierung wichtig sein könnte.[1]

Im Körper produzierte körpereigene Opioide [edit]

Das menschliche Genom enthält mehrere homologe Gene, von denen bekannt ist, dass sie für endogene Opioidpeptide kodieren.

  • Die Nukleotidsequenz des menschlichen Gens für Proopiomelanocortin (POMC) wurde 1980 charakterisiert.[2] Das POMC-Gen kodiert für endogene Opioide wie β-Endorphin und γ-Endorphin.[3]
  • Das menschliche Gen für die Enkephaline wurde 1982 isoliert und seine Sequenz beschrieben.[4]
  • Das menschliche Gen für Dynorphine (ursprünglich wegen der Sequenzähnlichkeit mit dem Enkephalin-Gen als “Enkephalin B”-Gen bezeichnet) wurde 1983 isoliert und seine Sequenz beschrieben.[5]
  • Das PNOC-Gen kodiert für Prepronociceptin, das in Nociceptin und möglicherweise zwei weitere Neuropeptide gespalten wird.[1]
  • Adrenorphin, Amidorphin und Leumorphin wurden in den 1980er Jahren entdeckt.
  • Die Endomorphine wurden in den 1990er Jahren entdeckt.
  • Opiorphin und Spinorphin, Enkephalinase-Hemmer (dh verhindern den Stoffwechsel von Enkephalinen).
  • Hemorphine, von Hämoglobin abgeleitete Opioidpeptide, einschließlich unter anderem Hemorphin-4, Valorphin und Spinorphin.

Obwohl es sich nicht um Peptide handelt, werden Codein und Morphin auch im menschlichen Körper produziert.[6][7]

Opioid-Nahrungspeptide[edit]

Exogene Opioidsubstanzen werden im Gegensatz zu Endorphinen als Exorphine bezeichnet. Exorphine umfassen opioide Nahrungspeptide wie Glutenexorphin und opioidhaltige Nahrungspeptide und sind hauptsächlich in Getreide und tierischer Milch enthalten. Sie ahmen die Wirkung von Endorphinen nach, weil sie an die gleichen Opioidrezeptoren im Gehirn binden.

Dies sind die häufigsten Exorphine:

Amphibische Opioidpeptide[edit]

Synthetische Opioidpeptide[edit]

Verweise[edit]

  1. ^ ein B Mollereau C, Simons MJ, Soularue P, Liners F, Vassart G, Meunier JC, Parmentier M (August 1996). “Struktur, Gewebeverteilung und chromosomale Lokalisation des Präpronociceptin-Gens”. Proz. Natl. Akad. Wissenschaft Vereinigte Staaten von Amerika. 93 (16): 8666–70. Bibcode:1996PNAS…93.8666M. mach:10.1073/pnas.93.16.8666. PMC 38730. PMID 8710928.
  2. ^ Chang AC, Cochet M, Cohen SN (August 1980). “Strukturelle Organisation der menschlichen genomischen DNA, die das Pro-Opiomelanocortin-Peptid kodiert”. Proz. Natl. Akad. Wissenschaft Vereinigte Staaten von Amerika. 77 (8): 4890–4. Bibcode:1980PNAS…77.4890C. mach:10.1073/pnas.77.8.4890. PMC 349954. PMID 6254047.
  3. ^ Ling N., Burgus R., Guillemin R. (November 1976). “Isolierung, Primärstruktur und Synthese von Alpha-Endorphin und Gamma-Endorphin, zwei Peptiden hypothalamisch-hypophysischen Ursprungs mit morphinomimetischer Aktivität”. Proz. Natl. Akad. Wissenschaft Vereinigte Staaten von Amerika. 73 (11): 3942–6. Bibcode:1976PNAS…73.3942L. mach:10.1073/pnas.73.11.3942. PMC 431275. PMID 1069261.
  4. ^ Noda M, Teranishi Y, Takahashi H, Toyosato M, Notake M, Nakanishi S, Numa S (Juni 1982). „Isolation und strukturelle Organisation des menschlichen Präproenkephalin-Gens“. Natur. 297 (5865): 431-4. Bibcode:1982Natur.297..431N. mach:10.1038/297431a0. PMID 6281660. S2CID 4371340.
  5. ^ S. Horikawa, T. Takai, M. Toyosato, H. Takahashi, M. Noda, H. Kakidani et al. (Dezember 1983). „Isolation und strukturelle Organisation des menschlichen Präproenkephalin B-Gens“. Natur. 306 (5943): 611-4. Bibcode:1983Natur.306..611H. mach:10.1038/306611a0. PMID 6316163. S2CID 4315441.
  6. ^ Stefano GB, Ptáček R, Kuželová H, Kream RM (2012). “Endogenes Morphin: aktueller Rückblick 2011” (PDF). Folia Biol. (Praha). 58 (2): 49–56. PMID 22578954. Positiver evolutionärer Druck hat offenbar die Fähigkeit bewahrt, chemisch authentisches Morphin, wenn auch in homöopathischen Konzentrationen, im gesamten Tierstamm zu synthetisieren. … Der scheinbar zufällige Befund eines Opiat-Alkaloid-sensitiven, Opioid-Peptid-insensitiven µ3-Opiat-Rezeptor-Subtyps, der von wirbellosen Immunozyten, menschlichen Blutmonozyten, Makrophagen-Zelllinien und menschlichen Blut-Granulozyten exprimiert wird, lieferte überzeugende validierende Beweise für eine autonome Rolle endogener Morphin als biologisch wichtiges zelluläres Signalmolekül (Stefano et al., 1993; Cruciani et al., 1994; Stefano und Scharrer, 1994; Makman et al., 1995). … Menschliche weiße Blutkörperchen haben die Fähigkeit, Morphin zu bilden und freizusetzen
  7. ^ ein B “μ-Rezeptor”. IUPHAR/BPS-Leitfaden zur PHARMAKOLOGIE. International Union of Basic and Clinical Pharmacology. 15. März 2017. Abgerufen 28. Dezember 2017. Bemerkungen: β-Endorphin ist der endogene Ligand mit der höchsten Potenz … Morphin kommt endogen vor [117].. …
    Wichtigste endogene Agonisten (Mensch)
    β-Endorphin (POMC, P01189), [Met]Enkephalin (PENK, P01210), [Leu]Enkephalin (PENK, P01210)
  8. ^ ein B C D e F g h ich J k l m n Li Y, Lefever MR, Muthu D, Bidlack JM, Bilsky EJ, Polt R (Februar 2012). “Opioide Glykopeptid-Analgetika aus endogenen Enkephalinen und Endorphinen”. Medizinische Chemie der Zukunft. 4 (2): 205–226. mach:10.4155/fmc.11.195. PMC 3306179. PMID 22300099. Tabelle 1: Endogene Opioidpeptide
  9. ^ ein B C D e F g h ich Toll L, Caló G, Cox BM, Chavkin C, Christie MJ, Civelli O, Connor M, Devi LA, Evans C, Henderson G, Höllt V, Kieffer B, Kitchen I, Kreek MJ, Liu-Chen LY, Meunier JC, Portoghese PS, Shippenberg TS, Simon EJ, Traynor JR, Ueda H, Wong YH (10. August 2015). “Opioidrezeptoren: Einführung”. IUPHAR/BPS-Leitfaden zur PHARMAKOLOGIE. International Union of Basic and Clinical Pharmacology. Abgerufen 20. Oktober 2017.
  10. ^ ein B C “δ-Rezeptor”. IUPHAR/BPS-Leitfaden zur PHARMAKOLOGIE. International Union of Basic and Clinical Pharmacology. 15. Mai 2017. Abgerufen 28. Dezember 2017. Wichtigste endogene Agonisten (Mensch)
    β-Endorphin (POMC, P01189), [Leu]Enkephalin (PENK, P01210), [Met]Enkephalin (PENK, P01210)
  11. ^ ein B “κ-Rezeptor”. IUPHAR/BPS-Leitfaden zur PHARMAKOLOGIE. International Union of Basic and Clinical Pharmacology. 21. Februar 2017. Abgerufen 28. Dezember 2017. Kommentare: Dynorphin A und Big Dynorphin sind die endogenen Liganden mit der höchsten Potenz …
    Wichtigste endogene Agonisten (Mensch)
    großes Dynorphin (PDYN, P01213), Dynorphin A (PDYN, P01213)
  12. ^ “Dynorphin A 1–8”. HMDB-Version 4.0. Datenbank des menschlichen Metaboloms. 27. September 2017. Abgerufen 20. Oktober 2017. Dynorphin A (1–8) ist eine Fraktion von Dynorphin A mit nur Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Peptidkette.
  13. ^ “Dynorphin A-(1–8): Biologische Aktivität”. IUPHAR/BPS-Leitfaden zur PHARMAKOLOGIE. International Union of Basic and Clinical Pharmacology. Abgerufen 20. Oktober 2017.
  14. ^ “Großes Dynorphin: Biologische Aktivität”. IUPHAR/BPS-Leitfaden zur PHARMAKOLOGIE. International Union of Basic and Clinical Pharmacology. Abgerufen 20. Oktober 2017. Wichtigste endogene Agonisten am κ-Rezeptor
  15. ^ „Großes Dynorphin: Struktur – Peptidsequenz“. IUPHAR/BPS-Leitfaden zur PHARMAKOLOGIE. International Union of Basic and Clinical Pharmacology. Abgerufen 20. Oktober 2017. Peptidsequenz
    YGGFLRRRIRPKLKWDNQKRYGGFLRRQFKVVT
  16. ^ Schwarzer C (September 2009). „30 Jahre Dynorphine – neue Erkenntnisse über ihre Funktion bei neuropsychiatrischen Erkrankungen“. Pharmakologie & Therapeutik. 123 (3): 353–370. mach:10.1016/j.pharmthera.2009.05.06. PMC 2872771. PMID 19481570.
  17. ^ “Dynorphin B (1-29)”. PubChem-Verbindung. United States National Library of Medicine – National Center for Biotechnology Information. 23. Dezember 2017. Abgerufen 28. Dezember 2017.
  18. ^ M. Suda, K. Nakao, T. Yoshimasa, M. Sakamoto, N. Morii, Y. Ikeda, C. Yanaihara, N. Yanaihara, S. Numa, H. Imura (September 1984). „Menschliches Leumorphin ist ein potenter Kappa-Opioid-Rezeptor-Agonist“. Neurowissenschaften Briefe. 50 (1–3): 49–52. mach:10.1016/0304-3940(84)90460-9. PMID 6149506. S2CID 42419724.
  19. ^ K. Inenaga, T. Nagatomo, K. Nakao, N. Yanaihara, H. Yamashita (Januar 1994). „Kappa-selektive Agonisten verringern postsynaptische Potenziale und Kalziumkomponenten von Aktionspotenzialen im supraoptischen Kern des Hypothalamus der Ratte in vitro“. Neurowissenschaften. 58 (2): 331–340. mach:10.1016/0306-4522(94)90039-6. PMID 7908725. S2CID 24631286.
  20. ^ “NOP-Rezeptor”. IUPHAR/BPS-Leitfaden zur PHARMAKOLOGIE. International Union of Basic and Clinical Pharmacology. 18. August 2017. Abgerufen 28. Dezember 2017. Natürliche/endogene Liganden
    Nociceptin/Orphanin FQ

Externe Links[edit]


after-content-x4